BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0344.Seq (736 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 42 7e-04 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 42 7e-04 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 42 7e-04 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 42 7e-04 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 42 7e-04 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 42 7e-04 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 40 0.002 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 38 0.011 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.015 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.060 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) 30 1.7 SB_50933| Best HMM Match : Laminin_EGF (HMM E-Value=0.0069) 30 2.2 SB_24840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 10 RRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 66 RRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 634 RRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 45 RRPVNCNTTHYRANW 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 7 RRPVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 47 RRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 1885 RRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 45 RRPVNCNTTHYRANW 59 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 7 RRPVNCNTTHYRANW 21 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 39 RRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 88 RRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 66 RRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 77 RRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 53 RRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRANW 685 RRPVNCNTTHYRANW Sbjct: 77 RRPVNCNTTHYRANW 91 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 643 SSISFVSAIRGGRYPIRPIVSRITIHWPS 729 SS S +A GG PIRPIVSRITIHWP+ Sbjct: 26 SSCSRAAATDGGA-PIRPIVSRITIHWPA 53 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 643 SSISFVSAIRGGRYPIRPIVSRITIHWPS 729 S+ S +A GG PIRPIVS ITIHWPS Sbjct: 28 STSSRAAATVGGA-PIRPIVSHITIHWPS 55 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRAN 688 RRPVNCNTTHYRAN Sbjct: 84 RRPVNCNTTHYRAN 97 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 729 RRPVNCNTTHYRAN 688 RRPVNCNTTHYRAN Sbjct: 27 RRPVNCNTTHYRAN 40 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 35.1 bits (77), Expect = 0.060 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 646 SISFVSAIRGGRYPIRPIVSRITIHWPS 729 S S ++A IRPIVSRITIHWPS Sbjct: 4 STSSIAAGIAVELAIRPIVSRITIHWPS 31 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +1 Query: 688 IRPIVSRITIHWPS 729 +RP+VSRITIHW S Sbjct: 33 LRPVVSRITIHWTS 46 >SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) Length = 338 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = -2 Query: 225 RFAYFIKLYTSMLHEQI*FKFSTMSFNFSLCFYI*LNKAI*TVYTCNVNY-PCFCFNSVF 49 R A+ +L ++ LHE++ +K +S L FY+ + V C +N P C N F Sbjct: 242 RRAWMRRLTSNSLHERVNYKVFKISLAIVLAFYLCYSCYWLQVTLCTLNEPPRLCANQTF 301 Query: 48 YF 43 F Sbjct: 302 RF 303 >SB_50933| Best HMM Match : Laminin_EGF (HMM E-Value=0.0069) Length = 233 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +3 Query: 246 FYH*KIKLGSVLSTACRRGCRTTAGSCYGRTAASCRCCGCSW 371 +Y K G + AC C G C+G TA C C W Sbjct: 53 YYEDKGDDGKMSCKACHESC---FGGCHGGTAKDCSACKSGW 91 >SB_24840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/44 (27%), Positives = 14/44 (31%) Frame = +3 Query: 294 RRGCRTTAGSCYGRTAASCRCCGCSWPAFLAVAAISISPICSTF 425 R C C + C CC C P I S +C F Sbjct: 217 RADCYVNLCCCVTCRCSVCTCCPCDCPCLQCAPCIVFSALCCPF 260 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 694 PIVSRITIHWPS 729 P +SRITIHWPS Sbjct: 77 PYMSRITIHWPS 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,011,944 Number of Sequences: 59808 Number of extensions: 170218 Number of successful extensions: 481 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -