BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0340.Seq (751 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 21 8.0 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 21.4 bits (43), Expect = 8.0 Identities = 17/63 (26%), Positives = 25/63 (39%) Frame = +1 Query: 199 DIVMNMDNYTNKIAVEEFLRCTGLVLCLGI*SSPLFMTT*WVKLLLYSNYSITLRTLGRS 378 +I + NY+ +F+R G L S L + WV L N + LG + Sbjct: 46 EISLTTGNYSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALGVT 105 Query: 379 TRL 387 T L Sbjct: 106 TVL 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,085 Number of Sequences: 336 Number of extensions: 4073 Number of successful extensions: 3 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -