BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0340.Seq (751 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 28 0.27 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 28 0.27 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 24 4.4 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 24 4.4 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 5.8 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 28.3 bits (60), Expect = 0.27 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 175 YYNIGKDYDIVMNMDNYTNKIAVEEFLRCTGLVL 276 Y N+ K M NY+N ++ LRC GL+L Sbjct: 43 YLNLPKHRLYQYLMYNYSNDAKTKQMLRCVGLIL 76 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 28.3 bits (60), Expect = 0.27 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 175 YYNIGKDYDIVMNMDNYTNKIAVEEFLRCTGLVL 276 Y N+ K M NY+N ++ LRC GL+L Sbjct: 43 YLNLPKHRLYQYLMYNYSNDAKTKQMLRCVGLIL 76 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 24.2 bits (50), Expect = 4.4 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 484 YNETVAIRALDNSDVEVIQDLTV 416 Y ++ LDNSD+++++ L V Sbjct: 44 YTAQYILKHLDNSDIDIVEKLPV 66 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 24.2 bits (50), Expect = 4.4 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = -3 Query: 323 THHVVIKSGEL 291 +HH+VIKSGEL Sbjct: 257 SHHLVIKSGEL 267 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 5.8 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -2 Query: 438 KSYKT*RLIEMHTRYIRQSCRTSQSP*RNRIIGIEQ*LHPSRCHKKR 298 K+Y L E+ R Q+ + + R RI+G+ LH + C +R Sbjct: 157 KNYGRQELWEICARLTHQAPSSDRPAQRTRILGLAGPLHGAGCTPER 203 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 785,105 Number of Sequences: 2352 Number of extensions: 16124 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -