BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0336.Seq (741 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57290| Best HMM Match : E1_dh (HMM E-Value=1.4e-05) 140 1e-33 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_39918| Best HMM Match : WAPL (HMM E-Value=1.8) 29 4.0 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_23756| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_7425| Best HMM Match : MAM (HMM E-Value=0.45) 29 5.2 >SB_57290| Best HMM Match : E1_dh (HMM E-Value=1.4e-05) Length = 266 Score = 140 bits (338), Expect = 1e-33 Identities = 70/130 (53%), Positives = 84/130 (64%) Frame = +3 Query: 315 IPIYRVMDNNGQIIDKNEEPNLDKATLINMYKTMVQLSHMDKILYESQRQGRISFYMTNY 494 IP+YRVMD G+II + +P + T Y M L+ MD+ILYESQRQGRISFYMTNY Sbjct: 74 IPVYRVMDRQGKIIIDSHDPKVTYCT----YLKMTLLNTMDRILYESQRQGRISFYMTNY 129 Query: 495 GEEGIT*AAPRHSHRKIWSSVQYREVGVFLYRGMTVTELVNQCYGNCEDPGKGRQMPVHY 674 GEE + + QYRE GV ++RG T+ + +NQCY N D GKGRQMPVHY Sbjct: 130 GEEATHFGSAAALEMEDLIMGQYREAGVLMWRGFTLADFMNQCYANQHDAGKGRQMPVHY 189 Query: 675 GSKHHNMVTI 704 GSK N VTI Sbjct: 190 GSKELNFVTI 199 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +1 Query: 64 YEQQYFRESVQS*TFVLDF*KQAIDVKSSDVRKRSITNIVKWLLSTRTRPETAQNGGGKI 243 Y++ Y + S T K +ID KS DVR +S + V+ ST + G K+ Sbjct: 740 YDEDYSKSSKGKATAAKKDKKLSIDAKSKDVRSKSKSKSVEKRTSTEKSSKEPDPGVSKM 799 Query: 244 AEFPAQ 261 P+Q Sbjct: 800 MGPPSQ 805 >SB_39918| Best HMM Match : WAPL (HMM E-Value=1.8) Length = 653 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = -3 Query: 298 SLKNFISLTYGALAPEILLSYHRHSVPFRAS---YASTKAISRYLLSIFFSHH 149 SL + S+T + + + Y+ HSV FRAS ++++ I+RY+ F HH Sbjct: 576 SLGTYSSITI--ITAYVFMPYYNHSVRFRASLGTFSNSTTITRYV----FEHH 622 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 124 KQAIDVKSSDVRKRSITNIVKWLLSTRTRPETAQNG--GGKIAEFPA 258 K+ +D+ +RK+ N++ + +++T+P + G G IAEF A Sbjct: 250 KRYVDLHEELLRKKFYDNVMNCIFTSKTQPSSLDPGILNGYIAEFVA 296 >SB_23756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 192 KPFHDICYRSFSHITTFDIDSLFSKIQYKS 103 K F ++C F +TTFDI +L +I+ KS Sbjct: 39 KSFKELCDEYFRTLTTFDIRNLTIRIRKKS 68 >SB_7425| Best HMM Match : MAM (HMM E-Value=0.45) Length = 300 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +3 Query: 396 INMYKTMVQLSHMDKILYESQRQGRISFYM 485 +N+YK + +H+D I +++ QGR S ++ Sbjct: 103 LNVYKAQISTAHIDMIWFKTGNQGRNSDFV 132 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,046,267 Number of Sequences: 59808 Number of extensions: 538948 Number of successful extensions: 1540 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1537 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -