BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0328.Seq (399 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 26 0.44 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 22 7.2 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 26.2 bits (55), Expect = 0.44 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -1 Query: 285 RSSPLTPGPFANLGRVVAFTVDHMCH--SELFCSRLRF 178 R P GP +N+ RV+A TV S ++C LRF Sbjct: 742 RMMPNKAGPSSNVRRVIALTVVAKVRYASPIWCHTLRF 779 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 139 GKGADRPQPKEKAKPQATTEQLR 207 GK + QP+++ +PQ +QL+ Sbjct: 252 GKPRSQQQPQQQQQPQQKQQQLQ 274 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 344,959 Number of Sequences: 2352 Number of extensions: 4904 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -