BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0325.Seq (743 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 76 3e-14 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 70 2e-12 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 67 1e-11 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 66 3e-11 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 66 3e-11 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 66 4e-11 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 66 4e-11 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 60 2e-09 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 58 1e-08 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 50 2e-06 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 43 3e-04 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 42 5e-04 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 42 7e-04 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 41 0.001 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 35 0.061 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 30 2.3 SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) 29 3.0 SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) 29 4.0 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 28 7.0 SB_46188| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-16) 28 7.0 SB_47771| Best HMM Match : Annexin (HMM E-Value=0) 28 9.2 SB_46415| Best HMM Match : Vicilin_N (HMM E-Value=2.8) 28 9.2 SB_24885| Best HMM Match : HOOK (HMM E-Value=0.00023) 28 9.2 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 76.2 bits (179), Expect = 3e-14 Identities = 37/88 (42%), Positives = 53/88 (60%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRGR 657 K++ ++ + HPDKNP N + A +FK++SEAYEVLSD+ KR +YD+YGKEGL + Sbjct: 21 KKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKRDIYDKYGKEGLTS---- 76 Query: 658 RSAADEDYEFGYASFPFHIPRSRRSIXR 741 + FG + H+ RS I R Sbjct: 77 -QGTPREETFGASGVHVHVFRSPDEIFR 103 Score = 43.2 bits (97), Expect = 2e-04 Identities = 28/105 (26%), Positives = 44/105 (41%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYRXXXXXXXXXXXXXXXXXXXEDSKKFLKLMRFFQMRENA 607 DYY VLGV R+A++ ++KKAYR E KK + +E Sbjct: 4 DYYEVLGVPRSASEEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKR 63 Query: 608 ECMTSTARKD*ITEGVVALPQTRTTNLAMXASHFTFRDPEEVFXE 742 + ++ ++G P+ T + H FR P+E+F E Sbjct: 64 DIYDKYGKEGLTSQGT---PREETFGASGVHVH-VFRSPDEIFRE 104 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 73.3 bits (172), Expect = 2e-13 Identities = 38/81 (46%), Positives = 52/81 (64%), Gaps = 3/81 (3%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRGR 657 K++ +K + + HPDKN D A +FKEI+EAYEVLSD +KR ++DQYG+EGL G Sbjct: 21 KKAYKKQAFKYHPDKNKDPG--AEEKFKEIAEAYEVLSDPQKREIFDQYGEEGLKGGVPP 78 Query: 658 RSAADED-YEF--GYASFPFH 711 A D D ++ G+ F FH Sbjct: 79 PGAGDADGFQMPEGFTYFQFH 99 Score = 32.3 bits (70), Expect = 0.43 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 +YY +LGV + A+D E+KKAY+ Sbjct: 4 NYYDILGVKKDASDQELKKAYK 25 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 70.1 bits (164), Expect = 2e-12 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGL-NNGRG 654 K++ +K + + HPDKN +A +F+E++EAYEVLSDE KRR YDQ+G+EGL NNG G Sbjct: 43 KKAFRKMAVKYHPDKN--KGKDAEEKFREVAEAYEVLSDENKRRQYDQFGEEGLKNNGFG 100 Score = 36.3 bits (80), Expect = 0.026 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 DYY++LGV R A+D +IKKA+R Sbjct: 26 DYYQILGVPRNASDKQIKKAFR 47 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 68.5 bits (160), Expect = 5e-12 Identities = 30/57 (52%), Positives = 43/57 (75%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNG 648 K+S +K + + HPDKNPD D RFK+IS+AYEVLSDE+KR++YD+ G++ + G Sbjct: 82 KKSYRKLALKYHPDKNPDEGD----RFKQISQAYEVLSDEKKRKIYDEGGEDAIKGG 134 Score = 31.9 bits (69), Expect = 0.56 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +2 Query: 431 YYRVLGVTRTATDTEIKKAYR 493 YY +L V TAT TEIKK+YR Sbjct: 66 YYDILNVPPTATATEIKKSYR 86 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 67.3 bits (157), Expect = 1e-11 Identities = 31/54 (57%), Positives = 41/54 (75%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGL 639 K++ +K + + HPDKN S A +FKEISEAYEVLSD +K+ +YDQYG+EGL Sbjct: 21 KKAYRKQALKYHPDKN--KSPGAEEKFKEISEAYEVLSDPKKKEIYDQYGEEGL 72 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 DYY VL V + A+ +IKKAYR Sbjct: 4 DYYAVLNVDKAASADDIKKAYR 25 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 66.1 bits (154), Expect = 3e-11 Identities = 29/59 (49%), Positives = 42/59 (71%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRG 654 K++ +K + E HPDKNPD + +FK+I+ AYE+LSD KR +YD+YG++GL G G Sbjct: 22 KKAYRKLAKELHPDKNPDTGE----KFKDITFAYEILSDPEKRELYDRYGEKGLREGAG 76 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 434 YRVLGVTRTATDTEIKKAYR 493 Y +LGV + A+D +IKKAYR Sbjct: 7 YDLLGVPQNASDNDIKKAYR 26 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 66.1 bits (154), Expect = 3e-11 Identities = 29/59 (49%), Positives = 42/59 (71%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRG 654 K++ +K + E HPDKNPD + +FK+I+ AYE+LSD KR +YD+YG++GL G G Sbjct: 22 KKAYRKLAKELHPDKNPDTGE----KFKDITFAYEILSDPEKRELYDRYGEKGLREGAG 76 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 434 YRVLGVTRTATDTEIKKAYR 493 Y +LGV + A+D +IKKAYR Sbjct: 7 YDLLGVPQNASDNDIKKAYR 26 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 65.7 bits (153), Expect = 4e-11 Identities = 30/70 (42%), Positives = 47/70 (67%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRGR 657 K+ +K S + HPDKN + S E +F++ +EAY+VLSD +KR +Y+Q+G+EGL +G Sbjct: 21 KKEYRKLSLKYHPDKNQEPSAEV--KFRQAAEAYDVLSDPKKRAIYNQFGEEGLKSGVPE 78 Query: 658 RSAADEDYEF 687 + A + Y F Sbjct: 79 KDAWTQGYTF 88 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 425 VDYYRVLGVTRTATDTEIKKAYR 493 +DYY +LG+TR+ATD +IKK YR Sbjct: 3 LDYYDILGLTRSATDADIKKEYR 25 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/78 (42%), Positives = 49/78 (62%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRGR 657 K + +K + + HPDKN D+ +A +F +I AYEVL+D+ +R++YDQ G+EGL N G Sbjct: 42 KRAYRKLAMKLHPDKNKDDP-KAQEKFHDIGAAYEVLADDDQRKIYDQRGEEGLKNA-GH 99 Query: 658 RSAADEDYEFGYASFPFH 711 R +D F + F FH Sbjct: 100 RDHSDPFSSF-FGGFGFH 116 Score = 31.5 bits (68), Expect = 0.75 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 D+Y +LGV R A+ +IK+AYR Sbjct: 25 DFYAILGVPRDASKNQIKRAYR 46 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 59.7 bits (138), Expect = 2e-09 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSD 594 K+S +K + + HPDKNP N +EA R+FKEISEAYEVLSD Sbjct: 20 KKSYRKLALKWHPDKNPQNKEEAERKFKEISEAYEVLSD 58 Score = 33.1 bits (72), Expect = 0.24 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = +2 Query: 422 MVDYYRVLGVTRTATDTEIKKAYR 493 M DYY +L V R+A++ +IKK+YR Sbjct: 1 MADYYDILEVPRSASEQDIKKSYR 24 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/57 (43%), Positives = 42/57 (73%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNG 648 K++ +K + + HPDKN DN++E+ R F+EI +AY+VLSD ++R YD++ ++ L G Sbjct: 21 KKTYRKLALKWHPDKNLDNAEESTRVFREIQQAYDVLSDPQERAFYDKHREQILRGG 77 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 431 YYRVLGVTRTATDTEIKKAYR 493 +Y VLGV R D+ +KK YR Sbjct: 5 HYEVLGVERDVDDSALKKTYR 25 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/54 (48%), Positives = 40/54 (74%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGL 639 K++ ++ + HPDKN ++ A +FKEISEAY+VL+D R+R ++D YG+EGL Sbjct: 21 KKAYRRQALIFHPDKNKNSG--AEEKFKEISEAYKVLTDPRQRDIFDMYGEEGL 72 Score = 35.1 bits (77), Expect = 0.061 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 +YY +LGV R A+D +IKKAYR Sbjct: 4 NYYAILGVPRNASDDDIKKAYR 25 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/59 (42%), Positives = 40/59 (67%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRG 654 K++ + + + HPD N D S A+ +F+E+SEAYEVLSD+ KR+ YD +G+ + +G Sbjct: 76 KKAYFELAKKYHPDTNKDKS--ASEKFQEVSEAYEVLSDDGKRKAYDSFGQTDFSGAQG 132 Score = 31.9 bits (69), Expect = 0.56 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAY 490 DYY++LGV A EIKKAY Sbjct: 59 DYYKILGVPPNANQKEIKKAY 79 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 50.0 bits (114), Expect = 2e-06 Identities = 26/63 (41%), Positives = 42/63 (66%), Gaps = 4/63 (6%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDE----ANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNN 645 K++ +K + + HPD++ SDE A ++FKE++EAY +LSD +K+R YD G++ L Sbjct: 176 KKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPKKKRRYDS-GQD-LEE 233 Query: 646 GRG 654 G G Sbjct: 234 GYG 236 Score = 35.5 bits (78), Expect = 0.046 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 DYY++L +++TA++ EIKKAY+ Sbjct: 159 DYYKILNISKTASEDEIKKAYK 180 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 50.0 bits (114), Expect = 2e-06 Identities = 26/63 (41%), Positives = 42/63 (66%), Gaps = 4/63 (6%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDE----ANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNN 645 K++ +K + + HPD++ SDE A ++FKE++EAY +LSD +K+R YD G++ L Sbjct: 176 KKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPKKKRRYDS-GQD-LEE 233 Query: 646 GRG 654 G G Sbjct: 234 GYG 236 Score = 35.5 bits (78), Expect = 0.046 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 DYY++L +++TA++ EIKKAY+ Sbjct: 159 DYYKILNISKTASEDEIKKAYK 180 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/44 (43%), Positives = 30/44 (68%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRR 609 K+ +K + + HPD++ DN +EA + F EI EAYE+LS + +R Sbjct: 811 KKRYKKLAMKWHPDRHRDNKEEAQKHFMEIQEAYEILSKLKTKR 854 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 434 YRVLGVTRTATDTEIKKAYR 493 YRVLG+T AT EIKK Y+ Sbjct: 796 YRVLGLTEDATQEEIKKRYK 815 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/52 (36%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = +1 Query: 478 KESVQKTSTERHPDK-NPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGK 630 K + +K S + HPD+ + ++A R+F+ +S++Y +LSD+ KR +YD+ G+ Sbjct: 32 KRAYRKISLQVHPDRADKGEKEKATRKFQALSKSYCILSDKEKRAIYDESGE 83 Score = 32.7 bits (71), Expect = 0.32 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = +2 Query: 434 YRVLGVTRTATDTEIKKAYR 493 Y VLGV++TA+++EIK+AYR Sbjct: 17 YDVLGVSKTASESEIKRAYR 36 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/47 (42%), Positives = 30/47 (63%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYD 618 K + K + E HPD NPD+ D +++ F ++SEAY LS +R+ YD Sbjct: 25 KSAFIKKTKEFHPDVNPDDPD-SHKAFIKVSEAYTTLSSSARRQQYD 70 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/47 (42%), Positives = 30/47 (63%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYD 618 K + K + E HPD NPD+ D +++ F ++SEAY LS +R+ YD Sbjct: 86 KSAFIKKTKEFHPDVNPDDPD-SHKAFIKVSEAYTTLSSSARRQQYD 131 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/58 (32%), Positives = 36/58 (62%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGR 651 + + ++ S + HPD+N + D+A +F+++ EVL DE KR+ YD ++G+ + R Sbjct: 2500 RRAYRRISLQLHPDRNKE--DDAELKFRKLVAVAEVLKDEDKRKRYDTILRDGMPDWR 2555 Score = 32.7 bits (71), Expect = 0.32 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 ++Y+VLGV TAT EI++AYR Sbjct: 2483 NFYQVLGVETTATQAEIRRAYR 2504 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 41.5 bits (93), Expect = 7e-04 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 1/76 (1%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYD-QYGKEGLNNGRG 654 + + ++ + + HPDKN + FKE+SEAYEVL D ++R +D ++ + Sbjct: 21 RRAYRRLALKYHPDKNAGTEEN----FKEVSEAYEVLCDPQQRERFDKKFAPDTFRYSYS 76 Query: 655 RRSAADEDYEFGYASF 702 +R A DYE F Sbjct: 77 KR-ATSFDYEVNCGGF 91 Score = 32.3 bits (70), Expect = 0.43 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 +YY VLGV R AT +I++AYR Sbjct: 4 NYYEVLGVERNATTDDIRRAYR 25 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/48 (39%), Positives = 31/48 (64%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQ 621 K++ K S + HPD++ SD+ + F+EI+EAY VL + R+ YD+ Sbjct: 89 KDAYYKLSMKHHPDRH-QGSDKKHEVFQEIAEAYSVLGNLESRKQYDR 135 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/48 (39%), Positives = 31/48 (64%) Frame = +1 Query: 478 KESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQ 621 K++ K S + HPD++ SD+ + F+EI+EAY VL + R+ YD+ Sbjct: 89 KDAYYKLSMKHHPDRH-QGSDKKHEVFQEIAEAYSVLGNLESRKQYDR 135 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/46 (39%), Positives = 32/46 (69%) Frame = +1 Query: 481 ESVQKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYD 618 ++ +K + + HPDKNPDN +A+ F ++S+A EVL+D + R ++ Sbjct: 25 KAYRKKALKCHPDKNPDN-PKASELFHKLSKALEVLTDPKARAAFN 69 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 +YY LGV + +T+ EI KAYR Sbjct: 7 NYYDTLGVHKDSTEKEILKAYR 28 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 35.1 bits (77), Expect = 0.061 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +1 Query: 490 QKTSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQY 624 +K + E HPDK +++D ++ F + +A +VL DE+ R YD + Sbjct: 309 KKKAKEWHPDKKRNDTD-SHEYFARLKKARDVLCDEKMRAKYDHW 352 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +1 Query: 457 NCY*H*NKESVQKTSTERHPDK-NPDNSDEANRRFKEISEAYEVLSDERKRRVYD 618 NC ++ +K + + HPD ++ +A + F +I+ A EVL+D KR YD Sbjct: 218 NCNKREITKAYRKLAVKWHPDNYKGEDKKKAEKMFIDIAAAKEVLTDPEKRAKYD 272 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 DYY++LG+ R EI KAYR Sbjct: 208 DYYKILGLKRNCNKREITKAYR 229 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 31.5 bits (68), Expect = 0.75 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 428 DYYRVLGVTRTATDTEIKKAYR 493 DYY + G++R AT EI+KA++ Sbjct: 28 DYYELFGISRDATSKEIRKAFK 49 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 31.1 bits (67), Expect = 0.99 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 Query: 425 VDYYRVLGVTRTATDTEIKKAYR 493 VDYY VL V + A + E+K AYR Sbjct: 130 VDYYAVLAVRKEANEDELKAAYR 152 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = +1 Query: 478 KESVQKTSTERHPDK------NPDNSDEANRRFKEISEAYEVLSDER 600 K + +K +E HPDK P+ + A ++ +EI +AYE++ ++ Sbjct: 92 KRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQK 138 >SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) Length = 219 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 529 DNSDEANRRFKEISEAYEVLSDERKRRVYD 618 D+ + A ++F+ I+ AYE L D +R YD Sbjct: 74 DDKENAIKKFQLIATAYETLKDPEQRNDYD 103 >SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) Length = 609 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +1 Query: 523 NPDNSDEANRRF---KEISEAYEVLSDERKRRVYDQYGKEGLNNG 648 NP ++ EA+ RF ++ S + VLSD +R Q K LNNG Sbjct: 102 NPCSAVEASTRFVQCEKCSHFFLVLSDSDSKRHIRQDSKASLNNG 146 >SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) Length = 665 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = +1 Query: 496 TSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKE 633 T T+R P+K P + ++ + E+ ++ K V D G E Sbjct: 67 TKTKRQPEKQPPAEEPDQEMYENLLSTQELKEEKEKESVPDAAGPE 112 >SB_46188| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-16) Length = 326 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 536 ELSGFLSGCLSVLVFCTLSLFQC 468 + SGF S C SV++ C +S+ +C Sbjct: 105 KFSGFYSCCASVVILCAMSVERC 127 >SB_47771| Best HMM Match : Annexin (HMM E-Value=0) Length = 529 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 481 ESVQKTSTERHPDKNPDNSDEANRRFKE 564 E +++TST P+KN +N D + + KE Sbjct: 251 EDIKETSTAAQPEKNDENKDIEDDKDKE 278 >SB_46415| Best HMM Match : Vicilin_N (HMM E-Value=2.8) Length = 222 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 496 TSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRGRRS 663 T ERH D+ + RR + A E + ER R VYD +E +N +R+ Sbjct: 155 TPFERHADQRRSGKRRSFRRSERSGPANEQDNWERDRHVYDVGRREENSNPHFQRT 210 >SB_24885| Best HMM Match : HOOK (HMM E-Value=0.00023) Length = 873 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 496 TSTERHPDKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRGRRS 663 T ERH D+ + RR + A E + ER R VYD +E +N +R+ Sbjct: 806 TPFERHADQRRSGKRRSFRRSERSGPANEQDNWERDRHVYDVGRREENSNPHFQRT 861 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,800,063 Number of Sequences: 59808 Number of extensions: 355104 Number of successful extensions: 881 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -