BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0325.Seq (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 42 2e-05 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 42 2e-05 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 39 1e-04 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 39 1e-04 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 39 1e-04 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 39 1e-04 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 39 1e-04 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 39 1e-04 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 39 1e-04 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 39 1e-04 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 27 0.46 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 24 4.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 10.0 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 23 10.0 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 42.3 bits (95), Expect = 2e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +1 Query: 541 EANRRFKEISEAYEVLSDERKRRVYDQYG 627 EA RF EI ++YE+LSD +RR +DQYG Sbjct: 1 EAETRFVEIKQSYELLSDSERRRAFDQYG 29 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 42.3 bits (95), Expect = 2e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +1 Query: 541 EANRRFKEISEAYEVLSDERKRRVYDQYG 627 EA RF EI ++YE+LSD +RR +DQYG Sbjct: 1 EAETRFVEIKQSYELLSDSERRRAFDQYG 29 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.1 bits (87), Expect = 1e-04 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 553 RFKEISEAYEVLSDERKRRVYDQYG 627 RF EI ++YE+LSD +RR +DQYG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 27.5 bits (58), Expect = 0.46 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 643 NGRGRRSAADEDYEFGYASFPFHIPRS 723 N G+R+A D E YA+ PF PR+ Sbjct: 536 NPNGQRTAVWRDLEARYANDPFRFPRN 562 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 24.2 bits (50), Expect = 4.3 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 556 FKEISEAYEVLSDERKRRVYDQYGKEGLNNGRGRRSAADEDYE 684 ++ I E Y+ + E R+ D+ + G NG G+ + D E Sbjct: 140 YRPILEGYKTFTKEFALRMGDKCCRNGNGNGCGQNGNGELDTE 182 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 10.0 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +1 Query: 475 NKESVQKTSTERHPDKNPDNSDEANRRFKEISE-AYEVLSD-ERKRRVYDQYGKEGLNNG 648 N + K T+ P+K+ +N D+ R K I + LS ++ + D++G G + G Sbjct: 281 NDSASDKPDTDGEPEKDEEN-DDLRRELKSIPDPTVGPLSYLKQYLELLDEFGPWGADRG 339 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/58 (20%), Positives = 28/58 (48%) Frame = +1 Query: 517 DKNPDNSDEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNGRGRRSAADEDYEFG 690 +KNP++ E+N +S + ++ + R + +EG+ + +R+ D + G Sbjct: 89 NKNPNSKSESNNLSLSLSLVDMIPEEKLRGRHSSESDREGMGHDSHKRTHRLSDSDGG 146 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,368 Number of Sequences: 2352 Number of extensions: 12627 Number of successful extensions: 60 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -