BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0317.Seq (764 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39850-6|AAM45366.1| 1081|Caenorhabditis elegans Polyq (poly glu... 29 3.6 U39850-3|AAM45367.2| 1647|Caenorhabditis elegans Polyq (poly glu... 29 3.6 >U39850-6|AAM45366.1| 1081|Caenorhabditis elegans Polyq (poly glutamine tract) toxicityenhancer protein 1, isoform a protein. Length = 1081 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -3 Query: 558 TRLSPVDSPARFPAPVRSGVSMHQ-QQLPIQSEPVQSRHADSSSCQSQLVLNDSRHP 391 T +P A+ P P+ GV+ HQ IQ P + R A++ Q+ N + P Sbjct: 243 TGAAPASRMAQQPVPLHQGVAPHQAAPQTIQQTPARGRPANAQLAQNAQQRNPQQVP 299 >U39850-3|AAM45367.2| 1647|Caenorhabditis elegans Polyq (poly glutamine tract) toxicityenhancer protein 1, isoform b protein. Length = 1647 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -3 Query: 558 TRLSPVDSPARFPAPVRSGVSMHQ-QQLPIQSEPVQSRHADSSSCQSQLVLNDSRHP 391 T +P A+ P P+ GV+ HQ IQ P + R A++ Q+ N + P Sbjct: 243 TGAAPASRMAQQPVPLHQGVAPHQAAPQTIQQTPARGRPANAQLAQNAQQRNPQQVP 299 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,093,444 Number of Sequences: 27780 Number of extensions: 372796 Number of successful extensions: 1142 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1142 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1830096852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -