BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0312.Seq (744 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46241-4|CAA86318.1| 837|Caenorhabditis elegans Hypothetical pr... 30 2.0 U39744-3|AAK18884.2| 563|Caenorhabditis elegans Hypothetical pr... 29 2.6 >Z46241-4|CAA86318.1| 837|Caenorhabditis elegans Hypothetical protein C38D4.5 protein. Length = 837 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +3 Query: 3 NQKNRFKIFSNYMKK*INKNTRFIKLFLLSVRMHRSHASKNQINNMRPMILEDRTAF 173 N RFK F + + N+N +K+ L + SH+S+N++ I+ T F Sbjct: 710 NATTRFKKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 766 >U39744-3|AAK18884.2| 563|Caenorhabditis elegans Hypothetical protein C03F11.3 protein. Length = 563 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/43 (34%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -3 Query: 517 LCDV-AGVLWVVSQELNIVHGLVQDTFISENVINNRINETHFL 392 +C V AG+++++ L +V GLV + N++NN+IN++ L Sbjct: 7 ICQVSAGIIFLIGAAL-LVAGLVIVLNVFPNIVNNQINDSKVL 48 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,386,144 Number of Sequences: 27780 Number of extensions: 338163 Number of successful extensions: 906 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -