BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0312.Seq (744 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54530.1 68416.m06034 hypothetical protein 29 3.3 At5g37950.1 68418.m04571 hypothetical protein 29 4.3 At1g25410.1 68414.m03154 adenylate isopentenyltransferase 6 / ad... 27 9.9 >At3g54530.1 68416.m06034 hypothetical protein Length = 273 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 594 TTIGRALDNPFXEMENVVWEQRVHFASCPSLGFV*XIRAL 713 T + R L+ E+EN++ + R+HFA G++ IR L Sbjct: 184 TNVHRELEKEKIELENIL-QDRIHFARKNEKGYIEKIRVL 222 >At5g37950.1 68418.m04571 hypothetical protein Length = 351 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +2 Query: 272 PHAPPPVSVKTTGPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRY 439 P + P +KT GP+W I ++ K + K +QE + VIYD F Y Sbjct: 40 PESLPASDLKTLGPIWFIIKLNKECEISFKKCLGQFLLQQQEE--IACVIYDEFMY 93 >At1g25410.1 68414.m03154 adenylate isopentenyltransferase 6 / adenylate dimethylallyltransferase / cytokinin synthase (IPT6) identical to adenylate isopentenyltransferase (IPT6) [Arabidopsis thaliana] GI:14279064 Length = 342 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -3 Query: 706 LIXYTNPSDGQLAKCTLCSQTTFSISXNGLSSALPIVV 593 L+ +P DG+L S T SIS S LPIVV Sbjct: 105 LLGQFHPQDGELTPAEFRSLATLSISKLISSKKLPIVV 142 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,499,138 Number of Sequences: 28952 Number of extensions: 319214 Number of successful extensions: 747 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -