BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0308.Seq (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 31 0.037 DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor... 25 3.2 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 4.3 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 24 5.6 DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor... 24 5.6 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 24 5.6 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 7.4 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 23 9.8 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 31.1 bits (67), Expect = 0.037 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +1 Query: 502 LMSAENLSTVGPIQRSKWLFTQRKTVLSIRRWLAVRLSRLLRRTV--QXFTKTVRLLTFI 675 L S++N+ G IQ W+ +RKT+ I R RL R R+ V Q F + +L F+ Sbjct: 442 LDSSDNVGEDGEIQHESWVARKRKTIDRINR----RLRRACRKAVKSQAFYWLIIILVFL 497 >DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIKSALNSVVYL 117 >DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIKSALNSVVYL 117 >DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIKSALNSVVYL 117 >DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSHCFTQSMKT*ILL 438 PTV RFS L+R+ F + H ++ + + L Sbjct: 86 PTVARFSGLLRMCWFLRNEHKIESALNSVVYL 117 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 294 WSLRPCDLEVKLLRDSRTVYSALAKEVDDYAGWIN 398 W LRP L + L + R ++ K+ +Y WI+ Sbjct: 248 WQLRPHVLTERNLEEFRCKWNNWTKQRRNYGTWIS 282 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 87 ITCSYPNAAVSYDFEHFFRNTKSNTRSLP 1 +T P+ YDF ++R T N +LP Sbjct: 87 LTGRRPDTVRLYDFYSYWRQTSGNYTTLP 115 >DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 533 PTVERFSALMRVQHFTGDSH 474 PTV RFS L+R+ F + H Sbjct: 86 PTVARFSGLLRMCWFLRNEH 105 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/48 (20%), Positives = 26/48 (54%) Frame = -3 Query: 707 LPLFPKQVVRIMNVNNRTVFVNXCTVLLSNLDKRTASHRRIDSTVFRC 564 L ++ ++ +R+ + + CTV++S+ KR + +++ + RC Sbjct: 20 LVVYLREKLRLCGTKSMCREMRACTVMVSSDRKRLTASSAVNACLTRC 67 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.4 bits (48), Expect = 7.4 Identities = 8/30 (26%), Positives = 19/30 (63%) Frame = +1 Query: 547 SKWLFTQRKTVLSIRRWLAVRLSRLLRRTV 636 ++W+ Q V+ +++ + VRL R +R ++ Sbjct: 438 ARWVAIQGNPVVRVQKTVLVRLDRSVRHSI 467 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.0 bits (47), Expect = 9.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 301 RDHTIPAVCHVVP 263 RD+T+P HV+P Sbjct: 386 RDYTVPGTKHVIP 398 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 789,940 Number of Sequences: 2352 Number of extensions: 15443 Number of successful extensions: 64 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -