BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0308.Seq (739 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01680.1 68414.m00086 U-box domain-containing protein 29 4.3 At5g52600.1 68418.m06531 myb family transcription factor (MYB82)... 28 7.4 At2g32680.1 68415.m03995 disease resistance family protein conta... 28 7.4 At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01... 28 7.4 At1g55610.1 68414.m06365 protein kinase family protein contains ... 27 9.8 >At1g01680.1 68414.m00086 U-box domain-containing protein Length = 308 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/52 (23%), Positives = 25/52 (48%) Frame = +3 Query: 309 CDLEVKLLRDSRTVYSALAKEVDDYAGWINNGGMFISRXTVRTQEYLRLHTL 464 C + ++++RD E +++ W+ +GG R + +T + L H L Sbjct: 239 CPISMEIMRDPHVAADGFTYEAEEFRKWLRSGG----RTSPKTNKPLENHNL 286 >At5g52600.1 68418.m06531 myb family transcription factor (MYB82) contains Pfam profile: PF00249 myb-like DNA-binding domain; identical to cDNA putative transcription factor (MYB82) mRNA, partial cds GI:3941515 Length = 201 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -2 Query: 507 HEGPTLHWGFPL-LYPKYEDVNTLVYEPC 424 H G +H G PL L Y D NTLV++PC Sbjct: 164 HFGYDVHVGSPLPLISHYPD-NTLVFDPC 191 >At2g32680.1 68415.m03995 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 890 Score = 27.9 bits (59), Expect = 7.4 Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -2 Query: 339 NLEAILLPNRTVEGTIPFRRC-AMSFRLLISSF**NRIHASL-R*LVERVTARYASPDNN 166 NLE + L N +EG+IP C S R L S NR+ L R V + ++ S NN Sbjct: 529 NLELVYLRNNNLEGSIPDALCDGASLRTLDVSH--NRLTGKLPRSFVNCSSLKFLSVINN 586 Query: 165 NI 160 I Sbjct: 587 RI 588 >At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01612: reticulocyte binding protein; contains TIGRFAM TIGR00864: polycystin cation channel protein; similar to fimbriae-associated protein Fap1 [Streptococcus parasanguinis] (GI:3929312) Length = 1498 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 570 EDGTIDPAMACSALVKVAKKNGAXVYEDCPVVDV 671 EDG ID + C + V V K V ED P +V Sbjct: 650 EDGEIDREVNCGSEVNVTKTTPVAVREDIPPKEV 683 >At1g55610.1 68414.m06365 protein kinase family protein contains Prosite:PS00107: Protein kinases ATP-binding region signature Length = 1166 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 354 CIQFSNLEAILLPNRTVEGTIP--FRRCAMSFRLLISS 247 C++ NLE ++L N + G+IP RC + +SS Sbjct: 471 CVKGGNLETLILNNNLLTGSIPESISRCTNMIWISLSS 508 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,862,820 Number of Sequences: 28952 Number of extensions: 317241 Number of successful extensions: 778 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -