BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0303.Seq (748 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 3.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.0 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 207 WPEICYS*SIAIGI*VPSGEKVKVTIDEAAF 299 WP + I G V SGE+V + +D+ F Sbjct: 176 WPYDTHRCRINFGSWVHSGEEVNIFLDKKGF 206 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 3.0 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 235 LPSEFEFLVVKRSK*QSMKQHSLNPMFPWIQ*GLNLKWSSQQN 363 LP + F V+K +K Q +NP F +I NL+ + +N Sbjct: 934 LPFVYTFNVIKLTKTSGTVQAQINPDFAFIV-NSNLRLTFSKN 975 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,615 Number of Sequences: 438 Number of extensions: 4288 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -