BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0302.Seq (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 24 1.5 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 22 4.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.9 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 7.9 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 402 GGMFISRSTVRTQEYLRLHTLGKAMGIPSEVLDP 503 GG F STV T LR + +G + LDP Sbjct: 108 GGCFSGESTVLTSTGLRRNLSSLQIGEKIQALDP 141 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 430 FVHKSIYVFILWVKQWESPVKCWTLM 507 F+ ++++FILWV + C T++ Sbjct: 151 FIFDNVWLFILWVGILSTIFLCDTIL 176 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 596 ACSALVQGC*EERCKGLRRLFRLLTFHYSHNLLRK 700 AC + EE + L+ +FRL SH ++R+ Sbjct: 537 ACGTMWHETPEEMMEFLKSVFRLDQDQCSHRIVRE 571 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 596 ACSALVQGC*EERCKGLRRLFRLLTFHYSHNLLRK 700 AC + EE + L+ +FRL SH ++R+ Sbjct: 537 ACGTMWHETPEEMMEFLKSVFRLDQDQCSHRIVRE 571 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 344 SRISKQFYFQIARSKGP 294 S IS+ FY+ A S GP Sbjct: 59 SEISENFYYLPAMSTGP 75 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,266 Number of Sequences: 336 Number of extensions: 3828 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -