BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0302.Seq (740 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1035 + 33659965-33660155,33660992-33661066,33661634-336616... 30 2.2 01_02_0126 + 11370869-11370987,11371914-11371955,11372449-11372512 28 9.0 >02_05_1035 + 33659965-33660155,33660992-33661066,33661634-33661670, 33662415-33662487,33662635-33662801 Length = 180 Score = 29.9 bits (64), Expect = 2.2 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 397 TMEACSYQEARFVHKSIYVFILWVKQWESPVKCW 498 TM SYQ+ + H + +++ W K + P + W Sbjct: 85 TMHLRSYQQGSWHHPNQGLYVYWAKSFAQPARLW 118 >01_02_0126 + 11370869-11370987,11371914-11371955,11372449-11372512 Length = 74 Score = 27.9 bits (59), Expect = 9.0 Identities = 21/66 (31%), Positives = 30/66 (45%) Frame = +1 Query: 505 MSAENLSTVGPISVQNGSLRNGRRYYRSGDGLQCACSRLLRRTVQRFTKTVPVVDVSLFA 684 M+A L T S+ L+ G + R + + R V FT T P D++LFA Sbjct: 5 MTATTLETTLAYSITATVLQRGWKMLRREERETMISMKGTGREVI-FTNTTPHKDIALFA 63 Query: 685 QPASEI 702 P+S I Sbjct: 64 YPSSPI 69 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,433,521 Number of Sequences: 37544 Number of extensions: 427761 Number of successful extensions: 1057 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -