BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0302.Seq (740 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82093-6|CAB05014.1| 256|Caenorhabditis elegans Hypothetical pr... 29 2.6 AF003139-11|AAK73871.1| 1503|Caenorhabditis elegans Hypothetical... 28 6.0 U41746-5|AAT81186.1| 492|Caenorhabditis elegans Innexin protein... 28 8.0 U41746-4|AAA83332.1| 559|Caenorhabditis elegans Innexin protein... 28 8.0 >Z82093-6|CAB05014.1| 256|Caenorhabditis elegans Hypothetical protein ZK39.7 protein. Length = 256 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +3 Query: 231 CGFIRKS*LTSGTTWHTAGMVWSLRPCDLEVKLLRDSRTVYSALAKEVDDYAGWINN 401 CG + T G+T TAG+VW+ D + + + ++ A + D W N Sbjct: 140 CGSLNSFQWTDGSTTGTAGLVWNTNQPDNKDSRSQQCLVLLASRASSIQDKWTWYAN 196 >AF003139-11|AAK73871.1| 1503|Caenorhabditis elegans Hypothetical protein F53G12.3 protein. Length = 1503 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +3 Query: 315 LEVKLLRDSRTVYSALAKEVDD--YAGWINN 401 LE+K+ T++SAL +E + Y GW NN Sbjct: 17 LEIKVQFSKETLFSALQQEAETQRYDGWYNN 47 >U41746-5|AAT81186.1| 492|Caenorhabditis elegans Innexin protein 10, isoform b protein. Length = 492 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 255 LTSGTTWHTAGMVWSLRPCDLEVKLL 332 L +GTTW +GM + CD +V+++ Sbjct: 237 LLNGTTWEQSGMFPRVSLCDFDVRVM 262 >U41746-4|AAA83332.1| 559|Caenorhabditis elegans Innexin protein 10, isoform a protein. Length = 559 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 255 LTSGTTWHTAGMVWSLRPCDLEVKLL 332 L +GTTW +GM + CD +V+++ Sbjct: 237 LLNGTTWEQSGMFPRVSLCDFDVRVM 262 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,348,660 Number of Sequences: 27780 Number of extensions: 365173 Number of successful extensions: 849 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -