BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0301.Seq (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 24 1.0 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 24 1.0 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 5.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 5.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 9.7 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 24.2 bits (50), Expect = 1.0 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 189 YSSTVHFYNIKGSLGQAQMLSVAT--WATCSCPSWRGSWRGSRTAARCSP 332 Y T+ Y + G+ Q + W+ C C G RG TA R P Sbjct: 123 YHFTLELYTVLGAACQVCTPNATNTVWSHCQCVLADGVERGILTANRMIP 172 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 24.2 bits (50), Expect = 1.0 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 189 YSSTVHFYNIKGSLGQAQMLSVAT--WATCSCPSWRGSWRGSRTAARCSP 332 Y T+ Y + G+ Q + W+ C C G RG TA R P Sbjct: 123 YHFTLELYTVLGAACQVCTPNATNTVWSHCQCVLADGVERGILTANRMIP 172 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -2 Query: 391 HDSLRLLVLSEHGGNLLQQGGEHRAAVLDPLQEPLQDGHEHVAHVA 254 H ++ + G N+ QQG H+ P+Q+ G + + A Sbjct: 183 HQQQHMMYGGQQGANMHQQGPPHQQ---PPIQQQPNQGQQPPGNTA 225 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -2 Query: 391 HDSLRLLVLSEHGGNLLQQGGEHRAAVLDPLQEPLQDGHEHVAHVA 254 H ++ + G N+ QQG H+ P+Q+ G + + A Sbjct: 185 HQQQHMMYGGQQGANMHQQGPPHQQ---PPIQQQPNQGQQPPGNTA 227 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.0 bits (42), Expect = 9.7 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 93 LVDAFCENILDIIRELPKDEQGKSYTRVGFITYS 194 LV A+ + LD+ E P+++ K +++G I +S Sbjct: 142 LVKAYGFDGLDLAWEFPENKPKKIRSKLGSIWHS 175 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,014 Number of Sequences: 336 Number of extensions: 2539 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -