BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0299.Seq (828 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A... 29 5.0 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 5.0 At1g62250.2 68414.m07023 expressed protein 29 5.0 At1g62250.1 68414.m07022 expressed protein 29 5.0 At1g53910.1 68414.m06137 AP2 domain-containing protein RAP2.12 (... 29 5.0 At3g12070.2 68416.m01503 geranylgeranyl transferase type II beta... 28 8.7 At3g12070.1 68416.m01502 geranylgeranyl transferase type II beta... 28 8.7 At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain... 28 8.7 At2g24680.1 68415.m02947 transcriptional factor B3 family protei... 28 8.7 At1g79720.1 68414.m09298 aspartyl protease family protein contai... 28 8.7 >At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A19) Identical to Cytochrome P450 (SP:Q9T0K0) [Arabidopsis thaliana]; similar to cytochrome P450LXXIA1, Persea americana, M32885 Length = 490 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 364 GVMVPFVYELDSLLGEDHSKLDGEVRFDDFL 272 G +P + +D + G+DH + + RFD+FL Sbjct: 221 GEYIPSLSWIDKIRGQDHKMEEVDKRFDEFL 251 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = +2 Query: 281 VKSYFPIQFRVIFTEQTVKLINKR-DHHALKLIDQQNHNKIAFGDSKDKTSKKVSWKFTP 457 V S + +QF V + + IN R D HAL ++ + + +K+ F D + + F P Sbjct: 76 VPSVYELQFAVPMSGAVLNNINPRLDAHALSVLLRHSESKLVFVDHHSSSLVLEAVSFLP 135 Query: 458 VLENKQSIL 484 E + ++ Sbjct: 136 KDERPRLVI 144 >At1g62250.2 68414.m07023 expressed protein Length = 223 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +1 Query: 19 LCLPSSSPCVRWLLTPHLHQELMTYWQSSCI*VSSLVNTRPLS 147 LC P + +RW TP + E+++ W+ C +++ R ++ Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At1g62250.1 68414.m07022 expressed protein Length = 267 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +1 Query: 19 LCLPSSSPCVRWLLTPHLHQELMTYWQSSCI*VSSLVNTRPLS 147 LC P + +RW TP + E+++ W+ C +++ R ++ Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At1g53910.1 68414.m06137 AP2 domain-containing protein RAP2.12 (RAP2.12) identical to AP2 domain containing protein GI:2281649 from [Arabidopsis thaliana] Length = 358 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 170 GKEGRGYQGSREAS-DRKRQEEHHGLRLPVWTKDGKEI 280 GK+ G G E S +RKR+ ++ G+R W K EI Sbjct: 103 GKKVTGLDGDAEKSANRKRKNQYRGIRQRPWGKWAAEI 140 >At3g12070.2 68416.m01503 geranylgeranyl transferase type II beta subunit, putative / RAB geranylgeranyltransferase beta subunit, putative similar to geranylgeranyl transferase type II beta subunit SP:P53611 [GI:1552549] [Homo sapiens] Length = 317 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -2 Query: 629 HGRPQGYPVGCFERWSAVAITVDDTVHPLEPFVFIELQVLLSSVDM 492 +GRP+ P C+ W ++ + D VH +E ++ +L S DM Sbjct: 220 NGRPEKLPDVCYSWWVLSSLIMIDRVHWIEKAKLVKF--ILDSQDM 263 >At3g12070.1 68416.m01502 geranylgeranyl transferase type II beta subunit, putative / RAB geranylgeranyltransferase beta subunit, putative similar to geranylgeranyl transferase type II beta subunit SP:P53611 [GI:1552549] [Homo sapiens] Length = 317 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -2 Query: 629 HGRPQGYPVGCFERWSAVAITVDDTVHPLEPFVFIELQVLLSSVDM 492 +GRP+ P C+ W ++ + D VH +E ++ +L S DM Sbjct: 220 NGRPEKLPDVCYSWWVLSSLIMIDRVHWIEKAKLVKF--ILDSQDM 263 >At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 697 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +3 Query: 108 YMSVVIGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQ 254 YM + +GEY AI +C+ L E K +KR N +DFA++ Sbjct: 100 YMQMGLGEYPNAINECNLAL-EASPRFSKALLKRARCYEALNKLDFAFR 147 >At2g24680.1 68415.m02947 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 851 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 477 LCLFSNTGVNFQETFLLVLSLESPNAILLWFC 382 +C+FSN NF F+ +L ES + LL+ C Sbjct: 300 VCIFSNLYSNFSLVFISILFGESVFSRLLYLC 331 >At1g79720.1 68414.m09298 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 484 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/55 (23%), Positives = 25/55 (45%) Frame = +2 Query: 311 VIFTEQTVKLINKRDHHALKLIDQQNHNKIAFGDSKDKTSKKVSWKFTPVLENKQ 475 V QT+K N + L ++ ++FG+ + S +TP+++N Q Sbjct: 274 VSLVSQTLKTFNGVFSYCLPSLEDGASGSLSFGNDSSVYTNSTSVSYTPLVQNPQ 328 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,438,040 Number of Sequences: 28952 Number of extensions: 371872 Number of successful extensions: 1137 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1137 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -