BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0298.Seq (830 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 36 0.040 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.070 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.070 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.070 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.070 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 33 0.28 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 33 0.28 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 33 0.38 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 32 0.50 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 32 0.50 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 32 0.50 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 32 0.66 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) 32 0.66 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 32 0.66 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 32 0.66 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 32 0.66 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 32 0.66 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 32 0.66 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 31 0.87 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 31 0.87 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 31 0.87 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 31 0.87 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 31 0.87 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 31 0.87 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 31 0.87 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 31 0.87 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 31 0.87 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 31 0.87 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_8102| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 31 1.1 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 31 1.1 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 31 1.1 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 31 1.1 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 31 1.1 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 31 1.1 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 31 1.5 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 31 1.5 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 31 1.5 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 31 1.5 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 31 1.5 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 31 1.5 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 31 1.5 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 31 1.5 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 31 1.5 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 31 1.5 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 31 1.5 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 31 1.5 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 31 1.5 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 31 1.5 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 31 1.5 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 31 1.5 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 31 1.5 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 31 1.5 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 31 1.5 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 31 1.5 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 31 1.5 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 31 1.5 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 31 1.5 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 31 1.5 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 31 1.5 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 31 1.5 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 31 1.5 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 31 1.5 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 31 1.5 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 31 1.5 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 31 1.5 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 31 1.5 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = -2 Query: 160 LAMLFVK*QVLRFSLYATRSARSGPXRHELVPNSCSPGDPLVLE 29 + M+ + V+ L T +R+ P + NSCSPGDPLVLE Sbjct: 81 MMMMIMMTMVMTMVLMMTMVSRNIPDHYSSPSNSCSPGDPLVLE 124 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -2 Query: 97 RSGPXRHELVPNSCSPGDPLVLE 29 R G R ++ NSCSPGDPLVLE Sbjct: 74 RRGAKRQQMASNSCSPGDPLVLE 96 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 106 RSARSGPXRHELVPNSCSPGDPLVLE 29 RSA+ + V NSCSPGDPLVLE Sbjct: 1054 RSAKKSELEEKEVSNSCSPGDPLVLE 1079 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H +V NSCSPGDPLVLE Sbjct: 345 HSIVSNSCSPGDPLVLE 361 >SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 RH + NSCSPGDPLVLE Sbjct: 4 RHNVTSNSCSPGDPLVLE 21 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -2 Query: 109 TRSARSGPXRHELVPNSCSPGDPLVLE 29 TR A P R LV NSCSPGDPLVLE Sbjct: 15 TRYAILSP-RARLVSNSCSPGDPLVLE 40 >SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = -2 Query: 121 SLYATRSARSGPXRHELVPNSCSPGDPLVLE 29 S++ +GP HE NSCSPGDPLVLE Sbjct: 3 SMFDYSLCNNGP--HEQTSNSCSPGDPLVLE 31 >SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -2 Query: 103 SARSGPXRHELVPNSCSPGDPLVLE 29 +AR+ P E NSCSPGDPLVLE Sbjct: 158 AARTKPLTQEKGSNSCSPGDPLVLE 182 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 100 ARSGPXRHELVPNSCSPGDPLVLE 29 +RS P R LV NSCSPGDPLVLE Sbjct: 9 SRSRPGRL-LVSNSCSPGDPLVLE 31 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 35.5 bits (78), Expect = 0.053 Identities = 21/36 (58%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 133 VLRFSLYATRSARSGPXRHELVP-NSCSPGDPLVLE 29 V R + Y RS P H VP NSCSPGDPLVLE Sbjct: 38 VARLARYCMRS----PDAHCRVPSNSCSPGDPLVLE 69 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/24 (62%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 97 RSGPXRHEL-VPNSCSPGDPLVLE 29 + GP + E+ + NSCSPGDPLVLE Sbjct: 41 KKGPVQDEIKISNSCSPGDPLVLE 64 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 94 SGPXRHELVPNSCSPGDPLVLE 29 S P R V NSCSPGDPLVLE Sbjct: 15 SEPKRVNAVSNSCSPGDPLVLE 36 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/21 (76%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Frame = -2 Query: 88 PXRHELVP-NSCSPGDPLVLE 29 P H L+P NSCSPGDPLVLE Sbjct: 16 PKHHFLLPSNSCSPGDPLVLE 36 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 97 RSGPXRHELVPNSCSPGDPLVLE 29 R+ R LV NSCSPGDPLVLE Sbjct: 16 RNPNTRAHLVSNSCSPGDPLVLE 38 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -2 Query: 103 SARSGPXRHELVPNSCSPGDPLVLE 29 SA++ +E+ NSCSPGDPLVLE Sbjct: 12 SAKNTIGSYEVTSNSCSPGDPLVLE 36 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 130 LRFSLYATRSARSGPXRHELVPNSCSPGDPLVLE 29 L S A R + +G + NSCSPGDPLVLE Sbjct: 2402 LNSSQSARRGSDTGGSSSAIASNSCSPGDPLVLE 2435 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H ++ NSCSPGDPLVLE Sbjct: 3 HNVISNSCSPGDPLVLE 19 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E++ NSCSPGDPLVLE Sbjct: 118 EIISNSCSPGDPLVLE 133 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = -2 Query: 151 LFVK*QVLRFSLYATRSARSGPXRHELVPNSCSPGDPLVLE 29 +FVK L + + T+ A P +H L NSCSPGDPLVLE Sbjct: 3 IFVKFLHLLYVWHDTK-APFKPGKH-LPSNSCSPGDPLVLE 41 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R L+ NSCSPGDPLVLE Sbjct: 21 RFPLISNSCSPGDPLVLE 38 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R ++ NSCSPGDPLVLE Sbjct: 14 RFRIISNSCSPGDPLVLE 31 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 88 PXRHELVPNSCSPGDPLVLE 29 P L+ NSCSPGDPLVLE Sbjct: 57 PVSRTLLSNSCSPGDPLVLE 76 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 +L+ NSCSPGDPLVLE Sbjct: 36 DLISNSCSPGDPLVLE 51 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R L+ NSCSPGDPLVLE Sbjct: 30 RVSLISNSCSPGDPLVLE 47 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 EL NSCSPGDPLVLE Sbjct: 10 ELTSNSCSPGDPLVLE 25 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 97 RSGPXRHELVPNSCSPGDPLVLE 29 R +H+ NSCSPGDPLVLE Sbjct: 9 REKTSKHKAKSNSCSPGDPLVLE 31 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R LV NSCSPGDPLVLE Sbjct: 23 RPMLVSNSCSPGDPLVLE 40 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/26 (65%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = -2 Query: 103 SARSGPXRHELVP-NSCSPGDPLVLE 29 SA S R+ + P NSCSPGDPLVLE Sbjct: 59 SAVSALYRYVMTPSNSCSPGDPLVLE 84 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 HE NSCSPGDPLVLE Sbjct: 3 HEKKSNSCSPGDPLVLE 19 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R E + NSCSPGDPLVLE Sbjct: 30 RMEYLSNSCSPGDPLVLE 47 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 LV NSCSPGDPLVLE Sbjct: 3 LVSNSCSPGDPLVLE 17 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = -2 Query: 112 ATRSARSGPXRHELVPNSCSPGDPLVLE 29 A+R+A S + NSCSPGDPLVLE Sbjct: 8 ASRAASSIVGQRRRESNSCSPGDPLVLE 35 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R E + NSCSPGDPLVLE Sbjct: 148 RLEKISNSCSPGDPLVLE 165 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 LV NSCSPGDPLVLE Sbjct: 9 LVSNSCSPGDPLVLE 23 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -2 Query: 106 RSARSGPXRHELVPNSCSPGDPLVLE 29 R +R G L NSCSPGDPLVLE Sbjct: 54 RESRVGHHTPILPSNSCSPGDPLVLE 79 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H V NSCSPGDPLVLE Sbjct: 22 HAHVSNSCSPGDPLVLE 38 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 LV NSCSPGDPLVLE Sbjct: 5 LVSNSCSPGDPLVLE 19 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 LV NSCSPGDPLVLE Sbjct: 2 LVSNSCSPGDPLVLE 16 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E V NSCSPGDPLVLE Sbjct: 6 EAVSNSCSPGDPLVLE 21 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -2 Query: 127 RFSLYATRSARSGPXRHELVPNSCSPGDPLVLE 29 RF L SA++G +H L NSCSPGDPLVLE Sbjct: 198 RFLLRYYGSAQNG--KH-LRSNSCSPGDPLVLE 227 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 33 LISNSCSPGDPLVLE 47 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E + NSCSPGDPLVLE Sbjct: 259 EYISNSCSPGDPLVLE 274 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 17 LISNSCSPGDPLVLE 31 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -2 Query: 115 YATRSARSGPXRHELVPNSCSPGDPLVLE 29 ++T ++ P + L NSCSPGDPLVLE Sbjct: 22 FSTLKTKNAPLK--LSSNSCSPGDPLVLE 48 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H V NSCSPGDPLVLE Sbjct: 29 HFRVSNSCSPGDPLVLE 45 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 8 LISNSCSPGDPLVLE 22 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 33 LISNSCSPGDPLVLE 47 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 33 LISNSCSPGDPLVLE 47 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 91 GPXRHELVPNSCSPGDPLVLE 29 G + V NSCSPGDPLVLE Sbjct: 8 GAVNRDEVSNSCSPGDPLVLE 28 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 33 LISNSCSPGDPLVLE 47 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 94 SGPXRHELVPNSCSPGDPLVLE 29 S P L NSCSPGDPLVLE Sbjct: 78 SVPKSEPLSSNSCSPGDPLVLE 99 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 33 LISNSCSPGDPLVLE 47 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 94 SGPXRHELVPNSCSPGDPLVLE 29 SG H L NSCSPGDPLVLE Sbjct: 78 SGLNEHSL-SNSCSPGDPLVLE 98 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 40 LISNSCSPGDPLVLE 54 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 33 LISNSCSPGDPLVLE 47 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H V NSCSPGDPLVLE Sbjct: 15 HLKVSNSCSPGDPLVLE 31 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 70 LISNSCSPGDPLVLE 84 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 34 LISNSCSPGDPLVLE 48 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 21 LISNSCSPGDPLVLE 35 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 16 LISNSCSPGDPLVLE 30 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 33 LISNSCSPGDPLVLE 47 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 31 LISNSCSPGDPLVLE 45 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 118 LYATRSARSGPXRHELVPNSCSPGDPLVLE 29 L A S R EL NSCSPGDPLVLE Sbjct: 8 LIAVDQPESSKDRLEL-SNSCSPGDPLVLE 36 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 77 IVSNSCSPGDPLVLE 91 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E V NSCSPGDPLVLE Sbjct: 2 EHVSNSCSPGDPLVLE 17 >SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -2 Query: 106 RSARSGPXRHELVPNSCSPGDPLVLE 29 R A G + NSCSPGDPLVLE Sbjct: 15 RDACQGGGAYGKTSNSCSPGDPLVLE 40 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 ++ V NSCSPGDPLVLE Sbjct: 8 NDAVSNSCSPGDPLVLE 24 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 11 MVSNSCSPGDPLVLE 25 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 1 MVSNSCSPGDPLVLE 15 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 88 PXRHELVPNSCSPGDPLVLE 29 P ++ V NSCSPGDPLVLE Sbjct: 25 PEGNKDVSNSCSPGDPLVLE 44 >SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 RH NSCSPGDPLVLE Sbjct: 12 RHLTGSNSCSPGDPLVLE 29 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E V NSCSPGDPLVLE Sbjct: 39 ENVSNSCSPGDPLVLE 54 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 + +++ NSCSPGDPLVLE Sbjct: 10 KRQVLSNSCSPGDPLVLE 27 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 +H NSCSPGDPLVLE Sbjct: 20 QHVAASNSCSPGDPLVLE 37 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 85 IVSNSCSPGDPLVLE 99 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 103 SARSGPXRHELVPNSCSPGDPLVLE 29 S+ S ++ NSCSPGDPLVLE Sbjct: 7 SSASSTTSAPVISNSCSPGDPLVLE 31 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 13 IVSNSCSPGDPLVLE 27 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 6 IVSNSCSPGDPLVLE 20 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 1 MVSNSCSPGDPLVLE 15 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 +L NSCSPGDPLVLE Sbjct: 660 QLASNSCSPGDPLVLE 675 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 ++V NSCSPGDPLVLE Sbjct: 26 KVVSNSCSPGDPLVLE 41 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -2 Query: 118 LYATRSARSGPXRHELVPNSCSPGDPLVLE 29 L TR R + NSCSPGDPLVLE Sbjct: 35 LLTTRIHYENKRRVYVTSNSCSPGDPLVLE 64 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 + V NSCSPGDPLVLE Sbjct: 15 DFVSNSCSPGDPLVLE 30 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 88 PXRHELVPNSCSPGDPLVLE 29 P + + NSCSPGDPLVLE Sbjct: 29 PKQESIRSNSCSPGDPLVLE 48 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 + + V NSCSPGDPLVLE Sbjct: 3 KSDRVSNSCSPGDPLVLE 20 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R ++ NSCSPGDPLVLE Sbjct: 16 RKKIPSNSCSPGDPLVLE 33 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H + NSCSPGDPLVLE Sbjct: 51 HFIPSNSCSPGDPLVLE 67 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R + NSCSPGDPLVLE Sbjct: 4 RFQATSNSCSPGDPLVLE 21 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H NSCSPGDPLVLE Sbjct: 3 HPFSSNSCSPGDPLVLE 19 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 3474 VVSNSCSPGDPLVLE 3488 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/19 (78%), Positives = 16/19 (84%), Gaps = 2/19 (10%) Frame = -2 Query: 79 HEL--VPNSCSPGDPLVLE 29 HEL + NSCSPGDPLVLE Sbjct: 73 HELRFLSNSCSPGDPLVLE 91 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 88 PXRHELVPNSCSPGDPLVLE 29 P + + NSCSPGDPLVLE Sbjct: 6 PKHKKSLSNSCSPGDPLVLE 25 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 14 IISNSCSPGDPLVLE 28 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 RHE NSCSPGDPLVLE Sbjct: 11 RHE-PSNSCSPGDPLVLE 27 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 13 IISNSCSPGDPLVLE 27 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 7 VVSNSCSPGDPLVLE 21 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 54 LLSNSCSPGDPLVLE 68 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 2 LLSNSCSPGDPLVLE 16 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 6 LLSNSCSPGDPLVLE 20 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 +V NSCSPGDPLVLE Sbjct: 19 VVSNSCSPGDPLVLE 33 >SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H + NSCSPGDPLVLE Sbjct: 11 HMMGSNSCSPGDPLVLE 27 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 5 IISNSCSPGDPLVLE 19 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 1/17 (5%) Frame = -2 Query: 76 ELVP-NSCSPGDPLVLE 29 E VP NSCSPGDPLVLE Sbjct: 43 ETVPSNSCSPGDPLVLE 59 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E V NSCSPGDPLVLE Sbjct: 2 EGVSNSCSPGDPLVLE 17 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 1 MISNSCSPGDPLVLE 15 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 1 LLSNSCSPGDPLVLE 15 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 4 IISNSCSPGDPLVLE 18 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/16 (93%), Positives = 15/16 (93%), Gaps = 1/16 (6%) Frame = -2 Query: 73 LVP-NSCSPGDPLVLE 29 LVP NSCSPGDPLVLE Sbjct: 27 LVPSNSCSPGDPLVLE 42 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L+ NSCSPGDPLVLE Sbjct: 7 LLSNSCSPGDPLVLE 21 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 Query: 97 RSGPXRHELVPNSCSPGDPLVLE 29 R+ P NSCSPGDPLVLE Sbjct: 19 RAPPRGRRAKSNSCSPGDPLVLE 41 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 103 SARSGPXRHELVPNSCSPGDPLVLE 29 SAR NSCSPGDPLVLE Sbjct: 504 SARESVPSSSTPSNSCSPGDPLVLE 528 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 112 ATRSARSGPXRHELVPNSCSPGDPLVLE 29 A R + P + NSCSPGDPLVLE Sbjct: 81 AMRKSIEPPSATGISSNSCSPGDPLVLE 108 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 13 IISNSCSPGDPLVLE 27 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 26 IISNSCSPGDPLVLE 40 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 + L NSCSPGDPLVLE Sbjct: 93 KRALASNSCSPGDPLVLE 110 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.66 Identities = 17/27 (62%), Positives = 18/27 (66%), Gaps = 3/27 (11%) Frame = -2 Query: 100 ARSGPXRHELVP---NSCSPGDPLVLE 29 A +G LVP NSCSPGDPLVLE Sbjct: 13 ADNGTNGASLVPRPSNSCSPGDPLVLE 39 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 1/17 (5%) Frame = -2 Query: 76 ELVP-NSCSPGDPLVLE 29 +L+P NSCSPGDPLVLE Sbjct: 23 QLLPSNSCSPGDPLVLE 39 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 30 VSNSCSPGDPLVLE 43 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -2 Query: 106 RSARSGPXRHELVPNSCSPGDPLVLE 29 R R+G R NSCSPGDPLVLE Sbjct: 14 RCKRAGSLRSR--SNSCSPGDPLVLE 37 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 10 VSNSCSPGDPLVLE 23 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 +H NSCSPGDPLVLE Sbjct: 59 KHTNPSNSCSPGDPLVLE 76 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 15 VSNSCSPGDPLVLE 28 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 91 GPXRHELVPNSCSPGDPLVLE 29 G + + NSCSPGDPLVLE Sbjct: 105 GRLKRSVESNSCSPGDPLVLE 125 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 2 VSNSCSPGDPLVLE 15 >SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) Length = 2119 Score = 31.9 bits (69), Expect = 0.66 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +1 Query: 199 KDVQASIH-RLSRVGVRAEQDTGDLESIINQIFTSAXPRRNCSRSRSLVSLIGL 357 +DV+ S+H LSR +R + G E I +F + P R+ SR +LIG+ Sbjct: 1711 RDVETSLHLTLSRETMRQSSNDGSEEGIAVSLFLTHSPHRSSSRILLDFNLIGV 1764 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -2 Query: 106 RSARSGPXRHELVPNSCSPGDPLVLE 29 +S R GP NSCSPGDPLVLE Sbjct: 38 KSGREGPGGS----NSCSPGDPLVLE 59 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 15 LTSNSCSPGDPLVLE 29 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 40 VSNSCSPGDPLVLE 53 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 117 VSNSCSPGDPLVLE 130 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 184 VSNSCSPGDPLVLE 197 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 34 VSNSCSPGDPLVLE 47 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 +H+ + NSCSPGDPLVLE Sbjct: 10 KHD-ISNSCSPGDPLVLE 26 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 14 VISNSCSPGDPLVLE 28 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 78 LTSNSCSPGDPLVLE 92 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 3 VSNSCSPGDPLVLE 16 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 214 VSNSCSPGDPLVLE 227 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 5 LASNSCSPGDPLVLE 19 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 5 VSNSCSPGDPLVLE 18 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 3 VSNSCSPGDPLVLE 16 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 7 VSNSCSPGDPLVLE 20 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 64 VSNSCSPGDPLVLE 77 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 6 LASNSCSPGDPLVLE 20 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 19 VSNSCSPGDPLVLE 32 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 4 VSNSCSPGDPLVLE 17 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 17 LASNSCSPGDPLVLE 31 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 10 VSNSCSPGDPLVLE 23 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 59 VSNSCSPGDPLVLE 72 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 45 DIASNSCSPGDPLVLE 60 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E+ NSCSPGDPLVLE Sbjct: 9 EIRSNSCSPGDPLVLE 24 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 4 VSNSCSPGDPLVLE 17 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 15 VSNSCSPGDPLVLE 28 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 14 VSNSCSPGDPLVLE 27 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 6 VSNSCSPGDPLVLE 19 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -2 Query: 103 SARSGPXRHELVPNSCSPGDPLVLE 29 SA GP + NSCSPGDPLVLE Sbjct: 10 SANIGP----ITSNSCSPGDPLVLE 30 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 15 VSNSCSPGDPLVLE 28 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 37 LTSNSCSPGDPLVLE 51 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 20 LASNSCSPGDPLVLE 34 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/22 (63%), Positives = 17/22 (77%), Gaps = 2/22 (9%) Frame = -2 Query: 88 PXRHEL--VPNSCSPGDPLVLE 29 P +H + + NSCSPGDPLVLE Sbjct: 29 PMQHAIPALSNSCSPGDPLVLE 50 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 30 VSNSCSPGDPLVLE 43 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 32 VSNSCSPGDPLVLE 45 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 10 VSNSCSPGDPLVLE 23 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 17 VSNSCSPGDPLVLE 30 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 14 VSNSCSPGDPLVLE 27 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 34 VSNSCSPGDPLVLE 47 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 8 QITSNSCSPGDPLVLE 23 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 88 LTSNSCSPGDPLVLE 102 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 11 LASNSCSPGDPLVLE 25 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 36 QMASNSCSPGDPLVLE 51 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E+ NSCSPGDPLVLE Sbjct: 12 EIRSNSCSPGDPLVLE 27 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 10 VSNSCSPGDPLVLE 23 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 18 VSNSCSPGDPLVLE 31 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 11 LASNSCSPGDPLVLE 25 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 3 LASNSCSPGDPLVLE 17 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 15 LTSNSCSPGDPLVLE 29 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 19 DIASNSCSPGDPLVLE 34 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 27 VSNSCSPGDPLVLE 40 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 7 LASNSCSPGDPLVLE 21 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 193 VSNSCSPGDPLVLE 206 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 9 VSNSCSPGDPLVLE 22 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 25 VISNSCSPGDPLVLE 39 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 11 LTSNSCSPGDPLVLE 25 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 L NSCSPGDPLVLE Sbjct: 4 LASNSCSPGDPLVLE 18 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 V NSCSPGDPLVLE Sbjct: 10 VSNSCSPGDPLVLE 23 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 5 ISNSCSPGDPLVLE 18 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 101 ISNSCSPGDPLVLE 114 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R + NSCSPGDPLVLE Sbjct: 19 RSKRASNSCSPGDPLVLE 36 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -2 Query: 94 SGPXRHELVPNSCSPGDPLVLE 29 S P ++ L NSCSPGDPLVLE Sbjct: 14 SNPPKN-LRSNSCSPGDPLVLE 34 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 16 ISNSCSPGDPLVLE 29 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E NSCSPGDPLVLE Sbjct: 8 ESTSNSCSPGDPLVLE 23 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 13 ILSNSCSPGDPLVLE 27 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 21 ISNSCSPGDPLVLE 34 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 +++ NSCSPGDPLVLE Sbjct: 11 KVLSNSCSPGDPLVLE 26 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 59 ISNSCSPGDPLVLE 72 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 9 ISNSCSPGDPLVLE 22 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 10 ISNSCSPGDPLVLE 23 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R + NSCSPGDPLVLE Sbjct: 4 RRLFLSNSCSPGDPLVLE 21 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 3 ISNSCSPGDPLVLE 16 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 3/20 (15%) Frame = -2 Query: 79 HELVP---NSCSPGDPLVLE 29 HEL+ NSCSPGDPLVLE Sbjct: 15 HELLAPTSNSCSPGDPLVLE 34 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 55 ILSNSCSPGDPLVLE 69 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 4 ISNSCSPGDPLVLE 17 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 52 ISNSCSPGDPLVLE 65 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 31.5 bits (68), Expect = 0.87 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 133 VLRFSLYATRSARSG-PXRHELVPNSCSPGDPLVLE 29 V R + T+ G R + NSCSPGDPLVLE Sbjct: 48 VERLGVQVTKQGNEGNTNRGKGGSNSCSPGDPLVLE 83 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 16 ISNSCSPGDPLVLE 29 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -2 Query: 118 LYATRSARSGPXRHELVPNSCSPGDPLVLE 29 L A + G + + NSCSPGDPLVLE Sbjct: 16 LAADNAYLQGNGQKKNASNSCSPGDPLVLE 45 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 17 KITSNSCSPGDPLVLE 32 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E+ NSCSPGDPLVLE Sbjct: 158 EVGSNSCSPGDPLVLE 173 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 21 ISNSCSPGDPLVLE 34 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 4 ISNSCSPGDPLVLE 17 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 47 ISNSCSPGDPLVLE 60 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 27 KIASNSCSPGDPLVLE 42 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 7 ISNSCSPGDPLVLE 20 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 4 ISNSCSPGDPLVLE 17 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 32 ISNSCSPGDPLVLE 45 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 +L NSCSPGDPLVLE Sbjct: 65 KLSSNSCSPGDPLVLE 80 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 18 ISNSCSPGDPLVLE 31 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 32 ISNSCSPGDPLVLE 45 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 + + NSCSPGDPLVLE Sbjct: 9 KQQATSNSCSPGDPLVLE 26 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 974 ISNSCSPGDPLVLE 987 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 6 ISNSCSPGDPLVLE 19 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 65 MLSNSCSPGDPLVLE 79 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -2 Query: 100 ARSGPXRHELVPNSCSPGDPLVLE 29 AR + NSCSPGDPLVLE Sbjct: 36 ARKRARAEAALSNSCSPGDPLVLE 59 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 1 ISNSCSPGDPLVLE 14 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 5 ISNSCSPGDPLVLE 18 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 5 ISNSCSPGDPLVLE 18 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/19 (73%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -2 Query: 82 RH-ELVPNSCSPGDPLVLE 29 RH + NSCSPGDPLVLE Sbjct: 21 RHLQAASNSCSPGDPLVLE 39 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 E+ NSCSPGDPLVLE Sbjct: 15 EVGSNSCSPGDPLVLE 30 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H + NSCSPGDPLVLE Sbjct: 5 HCSLSNSCSPGDPLVLE 21 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 32 ISNSCSPGDPLVLE 45 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.5 bits (68), Expect = 0.87 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -2 Query: 130 LRFSLYATRSARSGPXRHELVPNSCSPGDPLVLE 29 +R + T + G H NSCSPGDPLVLE Sbjct: 41 IREGISKTIMSEKGTVTHRR-SNSCSPGDPLVLE 73 >SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 76 ELVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 2 KITSNSCSPGDPLVLE 17 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 116 ISNSCSPGDPLVLE 129 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 79 HELVPNSCSPGDPLVLE 29 H NSCSPGDPLVLE Sbjct: 8 HNHKSNSCSPGDPLVLE 24 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 2 ISNSCSPGDPLVLE 15 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 2 ISNSCSPGDPLVLE 15 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 14 ISNSCSPGDPLVLE 27 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 2 ISNSCSPGDPLVLE 15 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 8 ISNSCSPGDPLVLE 21 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 82 RHELVPNSCSPGDPLVLE 29 R + NSCSPGDPLVLE Sbjct: 20 RKTISSNSCSPGDPLVLE 37 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 52 ISNSCSPGDPLVLE 65 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 90 ISNSCSPGDPLVLE 103 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 104 ILSNSCSPGDPLVLE 118 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 7 ISNSCSPGDPLVLE 20 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 73 LVPNSCSPGDPLVLE 29 ++ NSCSPGDPLVLE Sbjct: 12 ILSNSCSPGDPLVLE 26 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 6 ISNSCSPGDPLVLE 19 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 68 ISNSCSPGDPLVLE 81 >SB_8102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 690 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/62 (24%), Positives = 31/62 (50%) Frame = +1 Query: 109 SRTRKILKPVTSRRALRVRYC*CDVLRIISKDVQASIHRLSRVGVRAEQDTGDLESIINQ 288 S+T+K +PV+ R++ DV R++ D ++HR + V +L++ + Sbjct: 388 SKTQKNAEPVSERQSASRSTARADVKRLLETDTHVAMHRDTHVMAAKRMSDEELDAFLRP 447 Query: 289 IF 294 I+ Sbjct: 448 IY 449 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 30 ISNSCSPGDPLVLE 43 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 46 ISNSCSPGDPLVLE 59 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 45 ISNSCSPGDPLVLE 58 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 70 VPNSCSPGDPLVLE 29 + NSCSPGDPLVLE Sbjct: 591 ISNSCSPGDPLVLE 604 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,078,447 Number of Sequences: 59808 Number of extensions: 509421 Number of successful extensions: 3185 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3182 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2335516755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -