BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0297.Seq (832 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0378 - 2946916-2947590 29 3.4 01_01_0866 - 6765761-6766413,6766805-6766906,6767693-6768965 29 3.4 >12_01_0378 - 2946916-2947590 Length = 224 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/67 (26%), Positives = 35/67 (52%) Frame = +1 Query: 13 HRXAAALELVDPPGCRNSARGLDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNS 192 +R A + + +P G G+ ++P +++L ASL AA++ VP + ++ + Sbjct: 71 YRLAVNVTMYNPSG----RAGVHYDAIRPRLLLLLAGGASLGAANATVPGVFHQPRMSTT 126 Query: 193 VVVADYD 213 VV D+D Sbjct: 127 VVAIDFD 133 >01_01_0866 - 6765761-6766413,6766805-6766906,6767693-6768965 Length = 675 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = -3 Query: 398 GEDKSELNWETIPDDVLGALEPKLIGVLHAVHLVVSYQFVH 276 GED++ LNWET LGA G+ H +H + +FVH Sbjct: 462 GEDRTPLNWETRVRIALGAAR----GIAH-IHTENNGKFVH 497 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,651,591 Number of Sequences: 37544 Number of extensions: 420877 Number of successful extensions: 1235 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1235 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2291695380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -