BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0297.Seq (832 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 31 1.2 At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 31 1.2 At5g56690.1 68418.m07076 F-box family protein contains F-box dom... 28 8.7 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 346 PRTSSGIVSQLSSDLSSPKTRLSLCTSATVS 438 PR +G S L SDL P+T + CTS V+ Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTSVGVA 201 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = +1 Query: 76 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEK 252 +D + P+ +I+ + V +L S +P D+L++ L D DSA +K E K Sbjct: 154 VDLADLLPSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESK 212 >At5g56690.1 68418.m07076 F-box family protein contains F-box domain Pfam:PF00646 Length = 402 Score = 27.9 bits (59), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 652 NSVDSFRAQWYLQPAKYDNDVLFYIY 729 NS+++FR +WY + D D L I+ Sbjct: 363 NSLETFRVKWYYSEEQEDRDFLSLIF 388 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,750,713 Number of Sequences: 28952 Number of extensions: 320471 Number of successful extensions: 1034 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1033 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -