BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0296.Seq (842 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 40 0.003 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 39 0.006 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 38 0.008 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 38 0.010 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 38 0.013 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 38 0.013 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 37 0.018 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 37 0.018 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 37 0.024 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 37 0.024 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 37 0.024 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 37 0.024 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 37 0.024 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 37 0.024 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 37 0.024 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 37 0.024 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 37 0.024 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 37 0.024 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 37 0.024 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.041 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) 36 0.041 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 36 0.041 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_46741| Best HMM Match : UCR_TM (HMM E-Value=5.1) 36 0.041 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 36 0.041 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_24705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 36 0.054 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 36 0.054 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.054 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 36 0.054 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 36 0.054 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.054 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 36 0.054 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 36 0.054 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 36 0.054 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 36 0.054 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.054 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 36 0.054 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 36 0.054 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 36 0.054 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.054 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.054 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.054 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.054 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.054 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 36 0.054 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.054 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.054 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 36 0.054 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.054 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 36 0.054 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 36 0.054 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 36 0.054 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 36 0.054 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 36 0.054 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 36 0.054 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 36 0.054 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 36 0.054 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 36 0.054 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 36 0.054 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 36 0.054 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 36 0.054 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 36 0.054 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 36 0.054 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 36 0.054 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 36 0.054 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.054 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 36 0.054 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 36 0.054 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 36 0.054 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 36 0.054 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 36 0.054 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 36 0.054 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 36 0.054 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 36 0.054 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 36 0.054 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSARAR 79 ST AALELVDPPGCRNS +AR Sbjct: 6 STAVAAALELVDPPGCRNSIQAR 28 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSARARV 82 ST AALELVDPPGCRNS A V Sbjct: 6 STAVAAALELVDPPGCRNSMNANV 29 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSARARV 82 ST AALELVDPPGCRNS +RV Sbjct: 69 STAVAAALELVDPPGCRNSMDSRV 92 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSARARV 82 ST AALELVDPPGCRNS + +V Sbjct: 6 STAVAAALELVDPPGCRNSMKMKV 29 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSARAR 79 ST AALELVDPPGCRNS + R Sbjct: 6 STAVAAALELVDPPGCRNSMKQR 28 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSAR 73 ST AALELVDPPGCRNS R Sbjct: 6 STAVAAALELVDPPGCRNSIR 26 >SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 R+R EFLQPGGSTSSRAA VE Sbjct: 2 RSRIEFLQPGGSTSSRAAATAVE 24 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/25 (76%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS-ARARV 82 ST AALELVDPPGCRNS A+ RV Sbjct: 6 STAVAAALELVDPPGCRNSIAQCRV 30 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 RA+ EFLQPGGSTSSRAA VE Sbjct: 43 RAQIEFLQPGGSTSSRAAATAVE 65 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSARARV 82 ST AALELVDPPGCRNS +V Sbjct: 6 STAVAAALELVDPPGCRNSIVTKV 29 >SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 RA EFLQPGGSTSSRAA VE Sbjct: 40 RANIEFLQPGGSTSSRAAATAVE 62 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSARA 76 ST AALELVDPPGCRNS A Sbjct: 6 STAVAAALELVDPPGCRNSIAA 27 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSARARV 82 ST AALELVDPPGCRNS + V Sbjct: 61 STAVAAALELVDPPGCRNSMKVCV 84 >SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) Length = 149 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 75 ARAEFLQPGGSTSSRAAXXRVE 10 AR EFLQPGGSTSSRAA VE Sbjct: 24 ARIEFLQPGGSTSSRAAATAVE 45 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSARARV 82 ST AALELVDPPGCRNS + V Sbjct: 93 STAVAAALELVDPPGCRNSIQQMV 116 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSAR 73 ST AALELVDPPGCRNS + Sbjct: 6 STAVAAALELVDPPGCRNSIK 26 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSAR 73 ST AALELVDPPGCRNS + Sbjct: 6 STAVAAALELVDPPGCRNSMK 26 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 ++R EFLQPGGSTSSRAA VE Sbjct: 14 KSRIEFLQPGGSTSSRAAATAVE 36 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSAR 73 ST AALELVDPPGCRNS + Sbjct: 6 STAVAAALELVDPPGCRNSIK 26 >SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -3 Query: 81 TRARAEFLQPGGSTSSRAAXXRVE 10 TR EFLQPGGSTSSRAA VE Sbjct: 16 TRETIEFLQPGGSTSSRAAATAVE 39 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSAR 73 ST AALELVDPPGCRNS + Sbjct: 6 STAVAAALELVDPPGCRNSIK 26 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNSAR 73 ST AALELVDPPGCRNS + Sbjct: 6 STAVAAALELVDPPGCRNSIK 26 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 R++ EFLQPGGSTSSRAA VE Sbjct: 19 RSKIEFLQPGGSTSSRAAATAVE 41 >SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -3 Query: 81 TRARAEFLQPGGSTSSRAAXXRVE 10 TR EFLQPGGSTSSRAA VE Sbjct: 69 TRPTIEFLQPGGSTSSRAAATAVE 92 >SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -3 Query: 81 TRARAEFLQPGGSTSSRAAXXRVE 10 TR EFLQPGGSTSSRAA VE Sbjct: 9 TRRSIEFLQPGGSTSSRAAATAVE 32 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 RA EFLQPGGSTSSRAA VE Sbjct: 66 RAGIEFLQPGGSTSSRAAATAVE 88 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 26 STAVAAALELVDPPGCRNS 44 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 82 STAVAAALELVDPPGCRNS 100 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 650 STAVAAALELVDPPGCRNS 668 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 23 STAVAAALELVDPPGCRNS 41 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 63 STAVAAALELVDPPGCRNS 81 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 RA EFLQPGGSTSSRAA VE Sbjct: 40 RAGIEFLQPGGSTSSRAAATAVE 62 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 23 STAVAAALELVDPPGCRNS 41 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 43 STAVAAALELVDPPGCRNS 61 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 90 NSCSPGDPLVLERP 103 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 82 STAVAAALELVDPPGCRNS 100 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 11 STRXXAALELVDPPGCRNS 67 ST AALELVDPPGCRNS Sbjct: 93 STAVAAALELVDPPGCRNS 111 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 75 ARAEFLQPGGSTSSRAAXXRVE 10 +R EFLQPGGSTSSRAA VE Sbjct: 49 SRIEFLQPGGSTSSRAAATAVE 70 >SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 R + EFLQPGGSTSSRAA VE Sbjct: 48 RLKIEFLQPGGSTSSRAAATAVE 70 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 75 ARAEFLQPGGSTSSRAAXXRVE 10 +R EFLQPGGSTSSRAA VE Sbjct: 9 SRIEFLQPGGSTSSRAAATAVE 30 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 26 AALELVDPPGCRNSARA 76 AALELVDPPGCRNS R+ Sbjct: 11 AALELVDPPGCRNSIRS 27 >SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 75 ARAEFLQPGGSTSSRAAXXRVE 10 A+ EFLQPGGSTSSRAA VE Sbjct: 52 AKIEFLQPGGSTSSRAAATAVE 73 >SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 R + EFLQPGGSTSSRAA VE Sbjct: 30 RQKIEFLQPGGSTSSRAAATAVE 52 >SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 75 ARAEFLQPGGSTSSRAAXXRVE 10 A+ EFLQPGGSTSSRAA VE Sbjct: 28 AKIEFLQPGGSTSSRAAATAVE 49 >SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 75 ARAEFLQPGGSTSSRAAXXRVE 10 +R EFLQPGGSTSSRAA VE Sbjct: 2 SRIEFLQPGGSTSSRAAATAVE 23 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 27 RGEIEFLQPGGSTSSRAAATAVE 49 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 16 RIEFLQPGGSTSSRAAATAVE 36 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 19 RIEFLQPGGSTSSRAAATAVE 39 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -3 Query: 81 TRARAEFLQPGGSTSSRAAXXRVE 10 T+ EFLQPGGSTSSRAA VE Sbjct: 21 TKPSIEFLQPGGSTSSRAAATAVE 44 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 5 RIEFLQPGGSTSSRAAATAVE 25 >SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) Length = 213 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 139 RIEFLQPGGSTSSRAAATAVE 159 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 3 RIEFLQPGGSTSSRAAATAVE 23 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 R+ EFLQPGGSTSSRAA VE Sbjct: 14 RSSIEFLQPGGSTSSRAAATAVE 36 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 41 RIEFLQPGGSTSSRAAATAVE 61 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 228 RIEFLQPGGSTSSRAAATAVE 248 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 2 RIEFLQPGGSTSSRAAATAVE 22 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 3 RIEFLQPGGSTSSRAAATAVE 23 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 64 RIEFLQPGGSTSSRAAATAVE 84 >SB_46741| Best HMM Match : UCR_TM (HMM E-Value=5.1) Length = 106 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 16 RVHIEFLQPGGSTSSRAAATAVE 38 >SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) Length = 141 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 17 RIEFLQPGGSTSSRAAATAVE 37 >SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 7 RIEFLQPGGSTSSRAAATAVE 27 >SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 24 RIEFLQPGGSTSSRAAATAVE 44 >SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 78 RIEFLQPGGSTSSRAAATAVE 98 >SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 19 RIEFLQPGGSTSSRAAATAVE 39 >SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 64 RIEFLQPGGSTSSRAAATAVE 84 >SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/40 (47%), Positives = 23/40 (57%) Frame = -3 Query: 129 LK*KYILIRSXXXXXKTRARAEFLQPGGSTSSRAAXXRVE 10 LK + + + + R EFLQPGGSTSSRAA VE Sbjct: 37 LKRQILRVANISRIDALRPNIEFLQPGGSTSSRAAATAVE 76 >SB_24705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/25 (76%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -3 Query: 81 TRARA-EFLQPGGSTSSRAAXXRVE 10 TR R+ EFLQPGGSTSSRAA VE Sbjct: 56 TRKRSIEFLQPGGSTSSRAAATAVE 80 >SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -3 Query: 81 TRARAEFLQPGGSTSSRAAXXRVE 10 T+ EFLQPGGSTSSRAA VE Sbjct: 11 TKPTIEFLQPGGSTSSRAAATAVE 34 >SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 26 RIEFLQPGGSTSSRAAATAVE 46 >SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 12 RIEFLQPGGSTSSRAAATAVE 32 >SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 78 RARAEFLQPGGSTSSRAAXXRVE 10 R+ EFLQPGGSTSSRAA VE Sbjct: 9 RSSIEFLQPGGSTSSRAAATAVE 31 >SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 15 RIEFLQPGGSTSSRAAATAVE 35 >SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 44 RIEFLQPGGSTSSRAAATAVE 64 >SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 68 RIEFLQPGGSTSSRAAATAVE 88 >SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 72 RAEFLQPGGSTSSRAAXXRVE 10 R EFLQPGGSTSSRAA VE Sbjct: 17 RIEFLQPGGSTSSRAAATAVE 37 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 13 NSCSPGDPLVLERP 26 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 11 NSCSPGDPLVLERP 24 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 36 NSCSPGDPLVLERP 49 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 27 NSCSPGDPLVLERP 40 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 4 NSCSPGDPLVLERP 17 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 19 NSCSPGDPLVLERP 32 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 28 NSCSPGDPLVLERP 41 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 185 NSCSPGDPLVLERP 198 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 80 NSCSPGDPLVLERP 93 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 16 NSCSPGDPLVLERP 29 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 350 NSCSPGDPLVLERP 363 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 8 NSCSPGDPLVLERP 21 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 7 NSCSPGDPLVLERP 20 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 19 NSCSPGDPLVLERP 32 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 28 NSCSPGDPLVLERP 41 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 12 NSCSPGDPLVLERP 25 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 103 NSCSPGDPLVLERP 116 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 32 NSCSPGDPLVLERP 45 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 8 NSCSPGDPLVLERP 21 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 36 NSCSPGDPLVLERP 49 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 5 NSCSPGDPLVLERP 18 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 83 NSCSPGDPLVLERP 96 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 3 NSCSPGDPLVLERP 16 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 517 NSCSPGDPLVLERP 530 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 383 NSCSPGDPLVLERP 396 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 25 NSCSPGDPLVLERP 38 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 15 NSCSPGDPLVLERP 28 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 23 NSCSPGDPLVLERP 36 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 32 NSCSPGDPLVLERP 45 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 3 NSCSPGDPLVLERP 16 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 9 NSCSPGDPLVLERP 22 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 23 NSCSPGDPLVLERP 36 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 20 NSCSPGDPLVLERP 33 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 4 NSCSPGDPLVLERP 17 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 18 NSCSPGDPLVLERP 31 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 8 NSCSPGDPLVLERP 21 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 55 NSCSPGDPLVLERP 68 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 5 NSCSPGDPLVLERP 18 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 263 NSCSPGDPLVLERP 276 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 26 NSCSPGDPLVLERP 39 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 20 NSCSPGDPLVLERP 33 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 12 NSCSPGDPLVLERP 25 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 12 NSCSPGDPLVLERP 25 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 12 NSCSPGDPLVLERP 25 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 20 NSCSPGDPLVLERP 33 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 14 NSCSPGDPLVLERP 27 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 164 NSCSPGDPLVLERP 177 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 21 NSCSPGDPLVLERP 34 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 22 NSCSPGDPLVLERP 35 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 18 NSCSPGDPLVLERP 31 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 36 NSCSPGDPLVLERP 49 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 19 NSCSPGDPLVLERP 32 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 65 NSCSPGDPLVLERP 78 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 18 NSCSPGDPLVLERP 31 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 17 NSCSPGDPLVLERP 30 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 6 NSCSPGDPLVLERP 19 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 5 NSCSPGDPLVLERP 18 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 12 NSCSPGDPLVLERP 25 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 49 NSCSPGDPLVLERP 62 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 14 NSCSPGDPLVLERP 27 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 114 NSCSPGDPLVLERP 127 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 894 NSCSPGDPLVLERP 907 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 15 NSCSPGDPLVLERP 28 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 26 NSCSPGDPLVLERP 39 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 15 NSCSPGDPLVLERP 28 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 44 NSCSPGDPLVLERP 57 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 95 NSCSPGDPLVLERP 108 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 66 NSCSPGDPLVLERP 79 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 16 NSCSPGDPLVLERP 29 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 877 NSCSPGDPLVLERP 890 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 8 NSCSPGDPLVLERP 21 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 12 NSCSPGDPLVLERP 25 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 64 NSCSPGDPLVLERP 77 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 6 NSCSPGDPLVLERP 19 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 19 NSCSPGDPLVLERP 32 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 21 NSCSPGDPLVLERP 34 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 65 NSCSPGDPLVLERP 78 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 44 NSCSPGDPLVLERP 57 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 27 NSCSPGDPLVLERP 40 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 40 NSCSPGDPLVLERP 53 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 16 NSCSPGDPLVLERP 29 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 22 NSCSPGDPLVLERP 35 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 25 NSCSPGDPLVLERP 38 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 42 NSCSPGDPLVLERP 55 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 4 NSCSPGDPLVLERP 17 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 41 NSCSPGDPLVLERP 54 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 26 NSCSPGDPLVLERP 39 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 16 NSCSPGDPLVLERP 29 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 143 NSCSPGDPLVLERP 156 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 484 NSCSPGDPLVLERP 497 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 3 NSCSPGDPLVLERP 16 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 36 NSCSPGDPLVLERP 49 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 82 NSCSPGDPLVLERP 95 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 37 NSCSPGDPLVLERP 50 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 62 NSCSPGDPLVLERP 75 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 25 NSCSPGDPLVLERP 38 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 5 NSCSPGDPLVLERP 18 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 5 NSCSPGDPLVLERP 18 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 55 NSCSPGDPLVLERP 68 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 8 NSCSPGDPLVLERP 21 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 3 NSCSPGDPLVLERP 16 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 24 NSCSPGDPLVLERP 37 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 23 NSCSPGDPLVLERP 36 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 35 NSCSPGDPLVLERP 48 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 3 NSCSPGDPLVLERP 16 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 205 NSCSPGDPLVLERP 218 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 48 NSCSPGDPLVLERP 61 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 15 NSCSPGDPLVLERP 28 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 3 NSCSPGDPLVLERP 16 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 4 NSCSPGDPLVLERP 17 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 1023 NSCSPGDPLVLERP 1036 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 18 NSCSPGDPLVLERP 31 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 18 NSCSPGDPLVLERP 31 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 122 NSCSPGDPLVLERP 135 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 18 NSCSPGDPLVLERP 31 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 5 NSCSPGDPLVLERP 18 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 24 NSCSPGDPLVLERP 37 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 13 NSCSPGDPLVLERP 26 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 9 NSCSPGDPLVLERP 22 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 64 NSCSPGDPLVLERP 77 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 24 NSCSPGDPLVLERP 37 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 10 NSCSPGDPLVLERP 23 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 6 NSCSPGDPLVLERP 19 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 193 NSCSPGDPLVLERP 206 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 44 NSCSPGDPLVLERP 57 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 25 NSCSPGDPLVLERP 38 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 31 NSCSPGDPLVLERP 44 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 40 NSCSPGDPLVLERP 53 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 23 NSCSPGDPLVLERP 36 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 40 NSCSPGDPLVLERP 53 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 17 NSCSPGDPLVLERP 30 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 18 NSCSPGDPLVLERP 31 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 61 NSCSPGDPLVLERP 74 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 7 NSCSPGDPLVLERP 20 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 85 NSCSPGDPLVLERP 98 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 21 NSCSPGDPLVLERP 34 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 14 NSCSPGDPLVLERP 27 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 20 NSCSPGDPLVLERP 33 >SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 6 NSCSPGDPLVLERP 19 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 5 NSCSPGDPLVLERP 18 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 20 NSCSPGDPLVLERP 33 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 11 NSCSPGDPLVLERP 24 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 52 NSCSPGDPLVLERP 65 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 42 NSCSPGDPLVLERP 55 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 12 NSCSPGDPLVLERP 25 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERP 24 NSCSPGDPLVLERP Sbjct: 10 NSCSPGDPLVLERP 23 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,971,820 Number of Sequences: 59808 Number of extensions: 283597 Number of successful extensions: 2761 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2761 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -