BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0295.Seq (825 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 46 4e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 45 9e-05 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 44 2e-04 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 44 2e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 44 2e-04 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 44 2e-04 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 44 2e-04 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 43 3e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) 43 3e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 43 3e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 43 3e-04 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 43 3e-04 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 43 3e-04 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 42 5e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 42 5e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 42 5e-04 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 42 5e-04 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 42 5e-04 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 42 5e-04 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 42 5e-04 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 42 5e-04 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 42 6e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 42 6e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 42 6e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 42 6e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 42 6e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 42 6e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 42 6e-04 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 42 6e-04 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 42 6e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 42 6e-04 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 42 6e-04 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 42 6e-04 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 42 6e-04 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 42 8e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 42 8e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 42 8e-04 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 42 8e-04 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 41 0.001 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 41 0.001 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 41 0.001 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 41 0.001 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 41 0.001 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 41 0.001 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 41 0.001 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 41 0.001 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 41 0.001 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 41 0.001 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 41 0.001 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 41 0.001 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 41 0.001 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 41 0.001 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 41 0.001 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 41 0.001 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 41 0.001 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 41 0.001 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 41 0.001 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 41 0.001 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 41 0.001 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 41 0.001 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 41 0.001 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 41 0.001 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_526| Best HMM Match : GRP (HMM E-Value=8.5) 41 0.001 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 41 0.001 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 41 0.001 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 41 0.001 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 49.2 bits (112), Expect = 4e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 99 CGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 C R+RA + NSCSPGDPLVLERP RW Sbjct: 35 CARKRARAEAALSNSCSPGDPLVLERPPPRW 65 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 48.0 bits (109), Expect = 9e-06 Identities = 26/58 (44%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = -1 Query: 171 WGKHWIARAEN---PLVGTMMIFDPIDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 W KH I R + P + +F P S R+ + NSCSPGDPLVLERP RW Sbjct: 7 WQKHPIFRPLHYGIPRRCHVRVFMPATATSFRTSNKPTISNSCSPGDPLVLERPPPRW 64 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/29 (75%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = -1 Query: 90 ARSRASRL-VPNSCSPGDPLVLERPAXRW 7 +RSR RL V NSCSPGDPLVLERP RW Sbjct: 9 SRSRPGRLLVSNSCSPGDPLVLERPPPRW 37 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -1 Query: 96 GSARSRASRLVPNSCSPGDPLVLERPAXRW 7 G A +R+V NSCSPGDPLVLERP RW Sbjct: 3465 GKALIYVARVVSNSCSPGDPLVLERPPPRW 3494 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -1 Query: 99 CGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 CGS S + NSCSPGDPLVLERP RW Sbjct: 2 CGSRVSIKQQATSNSCSPGDPLVLERPPPRW 32 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -1 Query: 84 SRASRLVPNSCSPGDPLVLERPAXRW 7 S +RLV NSCSPGDPLVLERP RW Sbjct: 21 SPRARLVSNSCSPGDPLVLERPPPRW 46 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.4 bits (105), Expect = 3e-05 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -1 Query: 99 CGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 C ++R ++ NSCSPGDPLVLERP RW Sbjct: 9 CRASRKTRKKIPSNSCSPGDPLVLERPPPRW 39 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = -1 Query: 93 SARSRASRLVP-NSCSPGDPLVLERPAXRW 7 S R RAS +V NSCSPGDPLVLERP RW Sbjct: 3 SQRGRASDIVASNSCSPGDPLVLERPPPRW 32 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R R++ V NSCSPGDPLVLERP RW Sbjct: 8 RERSASQVSNSCSPGDPLVLERPPPRW 34 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -1 Query: 90 ARSRASRLVPNSCSPGDPLVLERPAXRW 7 ++S SR NSCSPGDPLVLERP RW Sbjct: 73 SQSPLSRFTSNSCSPGDPLVLERPPPRW 100 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 45.6 bits (103), Expect = 5e-05 Identities = 27/52 (51%), Positives = 32/52 (61%), Gaps = 3/52 (5%) Frame = +3 Query: 6 STAXRAALELVDPPGCRNSARGE-THATSPTR-SRLDR-KSSLCPQEDFQPE 152 STA AALELVDPPGCRNS HA PT ++ DR + + P D QP+ Sbjct: 26 STAVAAALELVDPPGCRNSMPDRPRHAARPTHDTQPDRPRHAARPTHDTQPD 77 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/28 (78%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = -1 Query: 87 RSRASRLV-PNSCSPGDPLVLERPAXRW 7 RSRA RL NSCSPGDPLVLERP RW Sbjct: 56 RSRAIRLSRSNSCSPGDPLVLERPPPRW 83 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.2 bits (102), Expect = 7e-05 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R + R++ NSCSPGDPLVLERP RW Sbjct: 11 RVQRFRIISNSCSPGDPLVLERPPPRW 37 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 ASR NSCSPGDPLVLERP RW Sbjct: 49 ASRSASNSCSPGDPLVLERPPPRW 72 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/36 (58%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -1 Query: 108 PIDCGSARS--RASRLVPNSCSPGDPLVLERPAXRW 7 P CG+ R R NSCSPGDPLVLERP RW Sbjct: 47 PARCGTKRKDKRLGHARSNSCSPGDPLVLERPPPRW 82 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 45.2 bits (102), Expect = 7e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R+V NSCSPGDPLVLERP RW Sbjct: 84 RIVSNSCSPGDPLVLERPPPRW 105 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R+ +S L+ NSCSPGDPLVLERP RW Sbjct: 1 RALSSFLLSNSCSPGDPLVLERPPPRW 27 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/28 (75%), Positives = 22/28 (78%), Gaps = 2/28 (7%) Frame = -1 Query: 84 SRASRL--VPNSCSPGDPLVLERPAXRW 7 SR SRL + NSCSPGDPLVLERP RW Sbjct: 144 SRNSRLEKISNSCSPGDPLVLERPPPRW 171 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = -1 Query: 147 AENPLVGTMMIFD---PIDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 A+NP M++ P G + + + R + NSCSPGDPLVLERP RW Sbjct: 3 ADNPYARRMVVNSSPGPASPGFS-TESPRSISNSCSPGDPLVLERPPPRW 51 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 93 SARSRASRLVPNSCSPGDPLVLERPAXRW 7 SA SR+ NSCSPGDPLVLERP RW Sbjct: 10 SANIVLSRVSSNSCSPGDPLVLERPPPRW 38 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 75 SRLVPNSCSPGDPLVLERPAXRW 7 + LV NSCSPGDPLVLERP RW Sbjct: 22 AHLVSNSCSPGDPLVLERPPPRW 44 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 + R S+ NSCSPGDPLVLERP RW Sbjct: 16 QKRRSKRASNSCSPGDPLVLERPPPRW 42 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -1 Query: 81 RASRLVPNSCSPGDPLVLERPAXRW 7 R S+ NSCSPGDPLVLERP RW Sbjct: 15 RGSQTASNSCSPGDPLVLERPPPRW 39 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -1 Query: 81 RASRLVPNSCSPGDPLVLERPAXRW 7 R ++++ NSCSPGDPLVLERP RW Sbjct: 8 RITKVLSNSCSPGDPLVLERPPPRW 32 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/28 (75%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = -1 Query: 87 RSRASR-LVPNSCSPGDPLVLERPAXRW 7 +S ASR L NSCSPGDPLVLERP RW Sbjct: 7 KSNASRTLRSNSCSPGDPLVLERPPPRW 34 >SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R+R +R NSCSPGDPLVLERP RW Sbjct: 57 RNRITRGGSNSCSPGDPLVLERPPPRW 83 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -1 Query: 90 ARSRAS-RLVPNSCSPGDPLVLERPAXRW 7 +RS S L+ NSCSPGDPLVLERP RW Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 75 SRLVPNSCSPGDPLVLERPAXRW 7 S L+ NSCSPGDPLVLERP RW Sbjct: 15 SFLISNSCSPGDPLVLERPPPRW 37 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 LV NSCSPGDPLVLERP RW Sbjct: 3 LVSNSCSPGDPLVLERPPPRW 23 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 75 SRLVPNSCSPGDPLVLERPAXRW 7 +R V NSCSPGDPLVLERP RW Sbjct: 181 TRRVSNSCSPGDPLVLERPPPRW 203 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/33 (60%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -1 Query: 99 CGSARS--RASRLVPNSCSPGDPLVLERPAXRW 7 CG +++ RA + NSCSPGDPLVLERP RW Sbjct: 121 CGESQTNLRARIVGSNSCSPGDPLVLERPPPRW 153 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 LV NSCSPGDPLVLERP RW Sbjct: 9 LVSNSCSPGDPLVLERPPPRW 29 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -1 Query: 90 ARSRAS-RLVPNSCSPGDPLVLERPAXRW 7 +RS S L+ NSCSPGDPLVLERP RW Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R R S L+ NSCSPGDPLVLERP RW Sbjct: 28 RYRVS-LISNSCSPGDPLVLERPPPRW 53 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -1 Query: 90 ARSRAS-RLVPNSCSPGDPLVLERPAXRW 7 +RS S L+ NSCSPGDPLVLERP RW Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -1 Query: 81 RASRLVPNSCSPGDPLVLERPAXRW 7 R + L+ NSCSPGDPLVLERP RW Sbjct: 2 RTAILLSNSCSPGDPLVLERPPPRW 26 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 LV NSCSPGDPLVLERP RW Sbjct: 5 LVSNSCSPGDPLVLERPPPRW 25 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -1 Query: 90 ARSRAS-RLVPNSCSPGDPLVLERPAXRW 7 +RS S L+ NSCSPGDPLVLERP RW Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -1 Query: 90 ARSRAS-RLVPNSCSPGDPLVLERPAXRW 7 +RS S L+ NSCSPGDPLVLERP RW Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -1 Query: 93 SARSRASRLVPNSCSPGDPLVLERPAXRW 7 +A S+A+R NSCSPGDPLVLERP RW Sbjct: 19 TANSKATR--SNSCSPGDPLVLERPPPRW 45 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 LV NSCSPGDPLVLERP RW Sbjct: 2 LVSNSCSPGDPLVLERPPPRW 22 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 A R + NSCSPGDPLVLERP RW Sbjct: 19 AGRSLSNSCSPGDPLVLERPPPRW 42 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 A+R+ NSCSPGDPLVLERP RW Sbjct: 318 ANRVRSNSCSPGDPLVLERPPPRW 341 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -1 Query: 90 ARSRAS-RLVPNSCSPGDPLVLERPAXRW 7 +RS S L+ NSCSPGDPLVLERP RW Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 +S AS NSCSPGDPLVLERP RW Sbjct: 4 KSFASCFASNSCSPGDPLVLERPPPRW 30 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 ++ +V NSCSPGDPLVLERP RW Sbjct: 10 SANIVSNSCSPGDPLVLERPPPRW 33 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 LV NSCSPGDPLVLERP RW Sbjct: 26 LVSNSCSPGDPLVLERPPPRW 46 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -1 Query: 90 ARSRAS-RLVPNSCSPGDPLVLERPAXRW 7 +RS S L+ NSCSPGDPLVLERP RW Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 +SR S NSCSPGDPLVLERP RW Sbjct: 22 KSRCSCQSSNSCSPGDPLVLERPPPRW 48 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -1 Query: 93 SARSRASRLVPNSCSPGDPLVLERPAXRW 7 S + S L NSCSPGDPLVLERP RW Sbjct: 3 SLMAHESGLTSNSCSPGDPLVLERPPPRW 31 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -1 Query: 90 ARSRAS-RLVPNSCSPGDPLVLERPAXRW 7 +RS S L+ NSCSPGDPLVLERP RW Sbjct: 23 SRSTVSISLISNSCSPGDPLVLERPPPRW 51 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -1 Query: 105 IDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 I C A S SR NSCSPGDPLVLERP RW Sbjct: 13 IRCKRAGSLRSR--SNSCSPGDPLVLERPPPRW 43 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/37 (54%), Positives = 22/37 (59%) Frame = -1 Query: 117 IFDPIDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 IFD + C + NSCSPGDPLVLERP RW Sbjct: 26 IFDKV-CSGPYYLQKKNASNSCSPGDPLVLERPPPRW 61 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 75 SRLVPNSCSPGDPLVLERPAXRW 7 +R+ NSCSPGDPLVLERP RW Sbjct: 20 TRVTSNSCSPGDPLVLERPPPRW 42 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 37 LISNSCSPGDPLVLERPPPRW 57 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 81 RASRLVPNSCSPGDPLVLERPAXRW 7 ++ R+ NSCSPGDPLVLERP RW Sbjct: 13 KSFRVTSNSCSPGDPLVLERPPPRW 37 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 + R S NSCSPGDPLVLERP RW Sbjct: 59 KRRKSSTTSNSCSPGDPLVLERPPPRW 85 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -1 Query: 105 IDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 + C RSR NSCSPGDPLVLERP RW Sbjct: 68 VHCRKQRSREVA-TSNSCSPGDPLVLERPPPRW 99 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 RL NSCSPGDPLVLERP RW Sbjct: 2 RLSSNSCSPGDPLVLERPPPRW 23 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 8 LISNSCSPGDPLVLERPPPRW 28 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 A+ ++ NSCSPGDPLVLERP RW Sbjct: 11 ANIIISNSCSPGDPLVLERPPPRW 34 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R+ NSCSPGDPLVLERP RW Sbjct: 24 RITSNSCSPGDPLVLERPPPRW 45 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 ++ ++ NSCSPGDPLVLERP RW Sbjct: 10 SANIISNSCSPGDPLVLERPPPRW 33 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R+ S+ NSCSPGDPLVLERP RW Sbjct: 110 RALVSKAESNSCSPGDPLVLERPPPRW 136 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 24 LISNSCSPGDPLVLERPPPRW 44 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -1 Query: 84 SRASRLVPNSCSPGDPLVLERPAXRW 7 SR + NSCSPGDPLVLERP RW Sbjct: 968 SRRKGWISNSCSPGDPLVLERPPPRW 993 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -1 Query: 114 FDPIDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 F + G + + NSCSPGDPLVLERP RW Sbjct: 28 FQKVTLGKIKQYTRKKRSNSCSPGDPLVLERPPPRW 63 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R V NSCSPGDPLVLERP RW Sbjct: 2 RRVSNSCSPGDPLVLERPPPRW 23 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 40 LISNSCSPGDPLVLERPPPRW 60 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 A+ L NSCSPGDPLVLERP RW Sbjct: 17 AAPLASNSCSPGDPLVLERPPPRW 40 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 70 LISNSCSPGDPLVLERPPPRW 90 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 34 LISNSCSPGDPLVLERPPPRW 54 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 21 LISNSCSPGDPLVLERPPPRW 41 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/30 (66%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -1 Query: 93 SARSR-ASRLVPNSCSPGDPLVLERPAXRW 7 S+R R S + NSCSPGDPLVLERP RW Sbjct: 53 SSRLRHGSNFLSNSCSPGDPLVLERPPPRW 82 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 16 LISNSCSPGDPLVLERPPPRW 36 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 90 ARSRASRLVPNSCSPGDPLVLERPAXRW 7 A R R NSCSPGDPLVLERP RW Sbjct: 20 APPRGRRAKSNSCSPGDPLVLERPPPRW 47 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 ++V NSCSPGDPLVLERP RW Sbjct: 26 KVVSNSCSPGDPLVLERPPPRW 47 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 ++ ++ NSCSPGDPLVLERP RW Sbjct: 10 SANIISNSCSPGDPLVLERPPPRW 33 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 75 SRLVPNSCSPGDPLVLERPAXRW 7 S ++ NSCSPGDPLVLERP RW Sbjct: 24 SLIISNSCSPGDPLVLERPPPRW 46 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -1 Query: 84 SRASRLVPNSCSPGDPLVLERPAXRW 7 SR + NSCSPGDPLVLERP RW Sbjct: 14 SRKVSITSNSCSPGDPLVLERPPPRW 39 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R + NSCSPGDPLVLERP RW Sbjct: 8 RYISNSCSPGDPLVLERPPPRW 29 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 +V NSCSPGDPLVLERP RW Sbjct: 347 IVSNSCSPGDPLVLERPPPRW 367 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R+ NSCSPGDPLVLERP RW Sbjct: 51 RVASNSCSPGDPLVLERPPPRW 72 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/29 (62%), Positives = 19/29 (65%) Frame = -1 Query: 93 SARSRASRLVPNSCSPGDPLVLERPAXRW 7 SA + NSCSPGDPLVLERP RW Sbjct: 10 SANIKGRHCASNSCSPGDPLVLERPPPRW 38 >SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) Length = 160 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = +2 Query: 8 HRXAGRSRTSGSPGLQEFGTRRDAR 82 HR GRSRTSGSPGLQEF +R AR Sbjct: 6 HRGGGRSRTSGSPGLQEFDNKRAAR 30 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 A+ ++ NSCSPGDPLVLERP RW Sbjct: 11 ANIVISNSCSPGDPLVLERPPPRW 34 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R+ S NSCSPGDPLVLERP RW Sbjct: 18 RNSNSHTASNSCSPGDPLVLERPPPRW 44 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 +V NSCSPGDPLVLERP RW Sbjct: 77 IVSNSCSPGDPLVLERPPPRW 97 >SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = +2 Query: 8 HRXAGRSRTSGSPGLQEFGTRRDARDLADP 97 HR GRSRTSGSPGLQEF R + +L P Sbjct: 6 HRGGGRSRTSGSPGLQEFDKRAECPELLHP 35 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R + NSCSPGDPLVLERP RW Sbjct: 76 RFLSNSCSPGDPLVLERPPPRW 97 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -1 Query: 84 SRASRLVPNSCSPGDPLVLERPAXRW 7 S+ + + NSCSPGDPLVLERP RW Sbjct: 41 SKKNFFISNSCSPGDPLVLERPPPRW 66 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R V NSCSPGDPLVLERP RW Sbjct: 62 RPVSNSCSPGDPLVLERPPPRW 83 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -1 Query: 90 ARSRASRLVPNSCSPGDPLVLERPAXRW 7 A R NSCSPGDPLVLERP RW Sbjct: 12 ANISCGRFASNSCSPGDPLVLERPPPRW 39 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -1 Query: 81 RASRLVPNSCSPGDPLVLERPAXRW 7 R +L NSCSPGDPLVLERP RW Sbjct: 62 RFPKLSSNSCSPGDPLVLERPPPRW 86 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = -1 Query: 81 RASRLVPNSCSPGDPLVLERPAXRW 7 R R NSCSPGDPLVLERP RW Sbjct: 5 RVKRTRSNSCSPGDPLVLERPPPRW 29 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 +V NSCSPGDPLVLERP RW Sbjct: 11 MVSNSCSPGDPLVLERPPPRW 31 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 +S + NSCSPGDPLVLERP RW Sbjct: 2418 SSAIASNSCSPGDPLVLERPPPRW 2441 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 3/33 (9%) Frame = -1 Query: 96 GSARSRASRLVP---NSCSPGDPLVLERPAXRW 7 G +S R +P NSCSPGDPLVLERP RW Sbjct: 46 GQRQSENLRTIPPVSNSCSPGDPLVLERPPPRW 78 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 +V NSCSPGDPLVLERP RW Sbjct: 1 MVSNSCSPGDPLVLERPPPRW 21 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 93 SARSRASRLVPNSCSPGDPLVLERPAXRW 7 S+ + S V NSCSPGDPLVLERP RW Sbjct: 32 SSPLQPSENVSNSCSPGDPLVLERPPPRW 60 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -1 Query: 81 RASRLVPNSCSPGDPLVLERPAXRW 7 R S + NSCSPGDPLVLERP RW Sbjct: 8 RESYALSNSCSPGDPLVLERPPPRW 32 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%), Gaps = 2/27 (7%) Frame = -1 Query: 81 RASRLVP--NSCSPGDPLVLERPAXRW 7 RA+R P NSCSPGDPLVLERP RW Sbjct: 24 RATRRKPQSNSCSPGDPLVLERPPPRW 50 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/30 (66%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -1 Query: 93 SARSRASR-LVPNSCSPGDPLVLERPAXRW 7 SA S S ++ NSCSPGDPLVLERP RW Sbjct: 8 SASSTTSAPVISNSCSPGDPLVLERPPPRW 37 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 +V NSCSPGDPLVLERP RW Sbjct: 6 IVSNSCSPGDPLVLERPPPRW 26 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 A+ V NSCSPGDPLVLERP RW Sbjct: 14 ANAKVSNSCSPGDPLVLERPPPRW 37 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -1 Query: 96 GSARSRASRLVPNSCSPGDPLVLERPAXRW 7 GSA++ L NSCSPGDPLVLERP RW Sbjct: 205 GSAQN-GKHLRSNSCSPGDPLVLERPPPRW 233 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 +V NSCSPGDPLVLERP RW Sbjct: 1 MVSNSCSPGDPLVLERPPPRW 21 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/37 (54%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -1 Query: 114 FDPIDCGSARSRASRLVP-NSCSPGDPLVLERPAXRW 7 FD ++ + L+P NSCSPGDPLVLERP RW Sbjct: 6 FDDVERVDKEPKHHFLLPSNSCSPGDPLVLERPPPRW 42 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 + + ++ + NSCSPGDPLVLERP RW Sbjct: 23 QKKGAKEISNSCSPGDPLVLERPPPRW 49 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/30 (60%), Positives = 19/30 (63%) Frame = -1 Query: 96 GSARSRASRLVPNSCSPGDPLVLERPAXRW 7 G R + NSCSPGDPLVLERP RW Sbjct: 4 GQFRYNNTSFTSNSCSPGDPLVLERPPPRW 33 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/33 (54%), Positives = 21/33 (63%) Frame = -1 Query: 105 IDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 I C ++ + NSCSPGDPLVLERP RW Sbjct: 49 IRCHHMDEPTAKKLSNSCSPGDPLVLERPPPRW 81 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 62 LLSNSCSPGDPLVLERPPPRW 82 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 ++ ++ NSCSPGDPLVLERP RW Sbjct: 10 SANILSNSCSPGDPLVLERPPPRW 33 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/33 (60%), Positives = 20/33 (60%) Frame = -1 Query: 105 IDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 I R SR NSCSPGDPLVLERP RW Sbjct: 9 ISANITRVTNSRPRSNSCSPGDPLVLERPPPRW 41 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 119 IISNSCSPGDPLVLERPPPRW 139 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 +S + NSCSPGDPLVLERP RW Sbjct: 18 SSNISSNSCSPGDPLVLERPPPRW 41 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = -1 Query: 84 SRASRLVPNSCSPGDPLVLERPAXRW 7 ++ ++ NSCSPGDPLVLERP RW Sbjct: 77 AKRQQMASNSCSPGDPLVLERPPPRW 102 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = +2 Query: 8 HRXAGRSRTSGSPGLQEFGTRRD 76 HR GRSRTSGSPGLQEF T RD Sbjct: 49 HRGGGRSRTSGSPGLQEFDTCRD 71 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 93 SARSRASRLVPNSCSPGDPLVLERPAXRW 7 +A SR R NSCSPGDPLVLERP RW Sbjct: 24 AASSRGGR--SNSCSPGDPLVLERPPPRW 50 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R + +R NSCSPGDPLVLERP RW Sbjct: 10 RRKPARPRSNSCSPGDPLVLERPPPRW 36 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 +V NSCSPGDPLVLERP RW Sbjct: 7 VVSNSCSPGDPLVLERPPPRW 27 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 54 LLSNSCSPGDPLVLERPPPRW 74 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -1 Query: 93 SARSRASRLVPNSCSPGDPLVLERPAXRW 7 SA + V NSCSPGDPLVLERP RW Sbjct: 10 SANIISIAFVSNSCSPGDPLVLERPPPRW 38 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 2 LLSNSCSPGDPLVLERPPPRW 22 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R + NSCSPGDPLVLERP RW Sbjct: 54 RALSNSCSPGDPLVLERPPPRW 75 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R+ NSCSPGDPLVLERP RW Sbjct: 11 RIQSNSCSPGDPLVLERPPPRW 32 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 +V NSCSPGDPLVLERP RW Sbjct: 19 VVSNSCSPGDPLVLERPPPRW 39 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 5 IISNSCSPGDPLVLERPPPRW 25 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 75 SRLVPNSCSPGDPLVLERPAXRW 7 S + NSCSPGDPLVLERP RW Sbjct: 44 STITSNSCSPGDPLVLERPPPRW 66 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -1 Query: 84 SRASRLVPNSCSPGDPLVLERPAXRW 7 S V NSCSPGDPLVLERP RW Sbjct: 8 SNMCSFVSNSCSPGDPLVLERPPPRW 33 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R R + NSCSPGDPLVLERP RW Sbjct: 6 RLRQLKKASNSCSPGDPLVLERPPPRW 32 >SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R NSCSPGDPLVLERP RW Sbjct: 8 RFASNSCSPGDPLVLERPPPRW 29 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 1 MISNSCSPGDPLVLERPPPRW 21 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -1 Query: 111 DPIDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 D + + +++ + NSCSPGDPLVLERP RW Sbjct: 6 DTLISANINTQSKLVASNSCSPGDPLVLERPPPRW 40 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -1 Query: 81 RASRLVPNSCSPGDPLVLERPAXRW 7 R + V NSCSPGDPLVLERP RW Sbjct: 9 RVTLEVSNSCSPGDPLVLERPPPRW 33 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 ++++ NSCSPGDPLVLERP RW Sbjct: 34 STQMASNSCSPGDPLVLERPPPRW 57 >SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) Length = 138 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -1 Query: 84 SRASRLVPNSCSPGDPLVLERPAXRW 7 SRA++ NSCSPGDPLVLERP RW Sbjct: 9 SRATK-TSNSCSPGDPLVLERPPPRW 33 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L+ NSCSPGDPLVLERP RW Sbjct: 1 LLSNSCSPGDPLVLERPPPRW 21 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = -1 Query: 111 DPIDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 D + + R R NSCSPGDPLVLERP RW Sbjct: 6 DTLISANIRLRGICAASNSCSPGDPLVLERPPPRW 40 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 4 IISNSCSPGDPLVLERPPPRW 24 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = -1 Query: 69 LVP-NSCSPGDPLVLERPAXRW 7 LVP NSCSPGDPLVLERP RW Sbjct: 27 LVPSNSCSPGDPLVLERPPPRW 48 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 R R R NSCSPGDPLVLERP RW Sbjct: 24 RYRICRERSNSCSPGDPLVLERPPPRW 50 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 +L NSCSPGDPLVLERP RW Sbjct: 660 QLASNSCSPGDPLVLERPPPRW 681 >SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 1/24 (4%) Frame = -1 Query: 75 SRLVP-NSCSPGDPLVLERPAXRW 7 SRL+ NSCSPGDPLVLERP RW Sbjct: 3 SRLITSNSCSPGDPLVLERPPPRW 26 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 ++ + NSCSPGDPLVLERP RW Sbjct: 10 SANIASNSCSPGDPLVLERPPPRW 33 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -1 Query: 87 RSRASRLVPNSCSPGDPLVLERPAXRW 7 ++ S + NSCSPGDPLVLERP RW Sbjct: 94 QTNKSLKISNSCSPGDPLVLERPPPRW 120 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 30 VSNSCSPGDPLVLERPPPRW 49 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 7 VSNSCSPGDPLVLERPPPRW 26 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 10 VSNSCSPGDPLVLERPPPRW 29 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = -1 Query: 99 CGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 C + + NSCSPGDPLVLERP RW Sbjct: 8 CRGEQGKYKSSTSNSCSPGDPLVLERPPPRW 38 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R NSCSPGDPLVLERP RW Sbjct: 15 RTTSNSCSPGDPLVLERPPPRW 36 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 2 VSNSCSPGDPLVLERPPPRW 21 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 15 LTSNSCSPGDPLVLERPPPRW 35 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 40 VSNSCSPGDPLVLERPPPRW 59 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R + NSCSPGDPLVLERP RW Sbjct: 8 RGISNSCSPGDPLVLERPPPRW 29 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 117 VSNSCSPGDPLVLERPPPRW 136 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 34 VSNSCSPGDPLVLERPPPRW 53 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R+ NSCSPGDPLVLERP RW Sbjct: 54 RVPSNSCSPGDPLVLERPPPRW 75 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 1066 VSNSCSPGDPLVLERPPPRW 1085 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 78 LTSNSCSPGDPLVLERPPPRW 98 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 3 VSNSCSPGDPLVLERPPPRW 22 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 214 VSNSCSPGDPLVLERPPPRW 233 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 17 KITSNSCSPGDPLVLERPPPRW 38 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 +L NSCSPGDPLVLERP RW Sbjct: 33 KLSSNSCSPGDPLVLERPPPRW 54 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 32 VSNSCSPGDPLVLERPPPRW 51 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +3 Query: 6 STAXRAALELVDPPGCRNSARGETHATSPTRSRL---DRKSSLCPQEDFQ 146 STA AALELVDPPGCRNS + + S +L +K S E F+ Sbjct: 6 STAVAAALELVDPPGCRNSIAADANQESENAEKLASDPQKESASKPESFK 55 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 5 LASNSCSPGDPLVLERPPPRW 25 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = +2 Query: 8 HRXAGRSRTSGSPGLQEFG--TRRDARDLADPQSIGSKIIIVPTRG 139 HR GRSRTSGSPGLQEF R+D + P + + ++ PTRG Sbjct: 6 HRGGGRSRTSGSPGLQEFDDVVRKDDNKVGKP-VVPAALMNRPTRG 50 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 5 VSNSCSPGDPLVLERPPPRW 24 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 3 VSNSCSPGDPLVLERPPPRW 22 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 7 VSNSCSPGDPLVLERPPPRW 26 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 27 KIASNSCSPGDPLVLERPPPRW 48 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 4 VSNSCSPGDPLVLERPPPRW 23 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 81 RASRLVPNSCSPGDPLVLERPAXRW 7 ++S NSCSPGDPLVLERP RW Sbjct: 47 KSSSRASNSCSPGDPLVLERPPPRW 71 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 6 LASNSCSPGDPLVLERPPPRW 26 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 4 VSNSCSPGDPLVLERPPPRW 23 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 ++ + NSCSPGDPLVLERP RW Sbjct: 10 SANITSNSCSPGDPLVLERPPPRW 33 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 11 VSNSCSPGDPLVLERPPPRW 30 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 25 VSNSCSPGDPLVLERPPPRW 44 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 15 VSNSCSPGDPLVLERPPPRW 34 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 17 LASNSCSPGDPLVLERPPPRW 37 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/30 (70%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = -1 Query: 93 SARSRASRLV-PNSCSPGDPLVLERPAXRW 7 SA SR V NSCSPGDPLVLERP RW Sbjct: 10 SANIICSRTVLSNSCSPGDPLVLERPPPRW 39 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 10 VSNSCSPGDPLVLERPPPRW 29 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 31 VSNSCSPGDPLVLERPPPRW 50 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 15 VSNSCSPGDPLVLERPPPRW 34 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 4 VSNSCSPGDPLVLERPPPRW 23 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 6 VSNSCSPGDPLVLERPPPRW 25 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 5 VISNSCSPGDPLVLERPPPRW 25 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 15 VSNSCSPGDPLVLERPPPRW 34 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 37 LTSNSCSPGDPLVLERPPPRW 57 >SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/37 (56%), Positives = 23/37 (62%), Gaps = 6/37 (16%) Frame = -1 Query: 99 CGSARSRASRLVPNSC------SPGDPLVLERPAXRW 7 CGS R R +R+ PN SPGDPLVLERP RW Sbjct: 4 CGSYRCRCNRINPNGVPKASQHSPGDPLVLERPPPRW 40 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 18 VSNSCSPGDPLVLERPPPRW 37 >SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 2 KITSNSCSPGDPLVLERPPPRW 23 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 11 LTSNSCSPGDPLVLERPPPRW 31 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 30 VSNSCSPGDPLVLERPPPRW 49 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 32 VSNSCSPGDPLVLERPPPRW 51 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 10 VSNSCSPGDPLVLERPPPRW 29 >SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -1 Query: 102 DCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 DC RSR S NSCSPGDPLVLERP RW Sbjct: 20 DC--CRSRGS----NSCSPGDPLVLERPPPRW 45 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 17 VSNSCSPGDPLVLERPPPRW 36 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 34 VSNSCSPGDPLVLERPPPRW 53 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -1 Query: 75 SRLVPNSCSPGDPLVLERPAXRW 7 +++ NSCSPGDPLVLERP RW Sbjct: 7 AQITSNSCSPGDPLVLERPPPRW 29 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 88 LTSNSCSPGDPLVLERPPPRW 108 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 11 LASNSCSPGDPLVLERPPPRW 31 >SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -1 Query: 90 ARSRASRLVPNSCSPGDPLVLERPAXRW 7 A SRA++ NSCSPGDPLVLERP RW Sbjct: 36 AYSRANK-GSNSCSPGDPLVLERPPPRW 62 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 8 VSNSCSPGDPLVLERPPPRW 27 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 10 VSNSCSPGDPLVLERPPPRW 29 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 23 VSNSCSPGDPLVLERPPPRW 42 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 11 LASNSCSPGDPLVLERPPPRW 31 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 3 LASNSCSPGDPLVLERPPPRW 23 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 15 LTSNSCSPGDPLVLERPPPRW 35 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/36 (58%), Positives = 24/36 (66%), Gaps = 4/36 (11%) Frame = -1 Query: 102 DCGSARSR----ASRLVPNSCSPGDPLVLERPAXRW 7 + GSA +R +S NSCSPGDPLVLERP RW Sbjct: 499 ESGSASARESVPSSSTPSNSCSPGDPLVLERPPPRW 534 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 48 PGDPLVLERPAXRW 7 PGDPLVLERP RW Sbjct: 664 PGDPLVLERPPPRW 677 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 27 VSNSCSPGDPLVLERPPPRW 46 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 7 LASNSCSPGDPLVLERPPPRW 27 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 193 VSNSCSPGDPLVLERPPPRW 212 >SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 75 SRLVPNSCSPGDPLVLERPAXRW 7 S+ NSCSPGDPLVLERP RW Sbjct: 2 SKRASNSCSPGDPLVLERPPPRW 24 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 9 VSNSCSPGDPLVLERPPPRW 28 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 17 VSNSCSPGDPLVLERPPPRW 36 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 25 VISNSCSPGDPLVLERPPPRW 45 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = -1 Query: 123 MMIFDPIDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 ++I + D R +R NSCSPGDPLVLERP RW Sbjct: 52 ILIGNKSDLKHLRMIENRRGSNSCSPGDPLVLERPPPRW 90 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 75 SRLVPNSCSPGDPLVLERPAXRW 7 S+ NSCSPGDPLVLERP RW Sbjct: 11 SQTTSNSCSPGDPLVLERPPPRW 33 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R+ NSCSPGDPLVLERP RW Sbjct: 14 RVESNSCSPGDPLVLERPPPRW 35 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 96 LASNSCSPGDPLVLERPPPRW 116 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 L NSCSPGDPLVLERP RW Sbjct: 4 LASNSCSPGDPLVLERPPPRW 24 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 V NSCSPGDPLVLERP RW Sbjct: 10 VSNSCSPGDPLVLERPPPRW 29 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 5 ISNSCSPGDPLVLERPPPRW 24 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/23 (78%), Positives = 20/23 (86%), Gaps = 1/23 (4%) Frame = -1 Query: 72 RLVP-NSCSPGDPLVLERPAXRW 7 +L+P NSCSPGDPLVLERP RW Sbjct: 23 QLLPSNSCSPGDPLVLERPPPRW 45 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = +3 Query: 6 STAXRAALELVDPPGCRNS---ARGETHATSPTRSRLDRKSSL 125 STA AALELVDPPGCRNS + G HA + S+ D S++ Sbjct: 6 STAVAAALELVDPPGCRNSMIGSGGREHAIAWKLSQSDHVSTI 48 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -1 Query: 99 CGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 C A S S NSCSPGDPLVLERP RW Sbjct: 6 CNIANSHTS----NSCSPGDPLVLERPPPRW 32 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 261 ISNSCSPGDPLVLERPPPRW 280 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/28 (71%), Positives = 20/28 (71%), Gaps = 3/28 (10%) Frame = -1 Query: 81 RASRLVP---NSCSPGDPLVLERPAXRW 7 R S L P NSCSPGDPLVLERP RW Sbjct: 154 RVSALPPHLSNSCSPGDPLVLERPPPRW 181 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 16 ISNSCSPGDPLVLERPPPRW 35 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -1 Query: 93 SARSRASRLVPNSCSPGDPLVLERPAXRW 7 + ++ L NSCSPGDPLVLERP RW Sbjct: 15 TGHAKNDALSSNSCSPGDPLVLERPPPRW 43 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = -1 Query: 108 PIDCGSARSRASRLVPNSCSPGDPLVLERPAXRW 7 P D +S+ NSCSPGDPLVLERP RW Sbjct: 20 PADNLCKKSQDISKTSNSCSPGDPLVLERPPPRW 53 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 21 ISNSCSPGDPLVLERPPPRW 40 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -1 Query: 72 RLVPNSCSPGDPLVLERPAXRW 7 R NSCSPGDPLVLERP RW Sbjct: 31 RKTSNSCSPGDPLVLERPPPRW 52 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/31 (64%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -1 Query: 93 SARSRASRLVP--NSCSPGDPLVLERPAXRW 7 S SR P NSCSPGDPLVLERP RW Sbjct: 5 SVESRVGVRTPTSNSCSPGDPLVLERPPPRW 35 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = -1 Query: 96 GSARSRASRLVPNSCSPGDPLVLERPAXRW 7 G +S + NSCSPGDPLVLER A RW Sbjct: 44 GGRQSNVHFIPSNSCSPGDPLVLERAAPRW 73 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 A+ + NSCSPGDPLVLERP RW Sbjct: 11 ANIFLSNSCSPGDPLVLERPPPRW 34 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 59 ISNSCSPGDPLVLERPPPRW 78 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 9 ISNSCSPGDPLVLERPPPRW 28 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 3 ISNSCSPGDPLVLERPPPRW 22 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPAXRW 7 ++ NSCSPGDPLVLERP RW Sbjct: 55 ILSNSCSPGDPLVLERPPPRW 75 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 13 ISNSCSPGDPLVLERPPPRW 32 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 4 ISNSCSPGDPLVLERPPPRW 23 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 52 ISNSCSPGDPLVLERPPPRW 71 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 51 ISNSCSPGDPLVLERPPPRW 70 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 16 ISNSCSPGDPLVLERPPPRW 35 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 78 ASRLVPNSCSPGDPLVLERPAXRW 7 A + NSCSPGDPLVLERP RW Sbjct: 7 AQPVTSNSCSPGDPLVLERPPPRW 30 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 21 ISNSCSPGDPLVLERPPPRW 40 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPAXRW 7 + NSCSPGDPLVLERP RW Sbjct: 4 ISNSCSPGDPLVLERPPPRW 23 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,497,485 Number of Sequences: 59808 Number of extensions: 564467 Number of successful extensions: 3570 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3569 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2311562737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -