BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0295.Seq (825 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 27 0.70 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 26 1.2 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 25 2.1 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 25 2.1 Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. 23 8.6 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.6 AJ000038-1|CAA03874.1| 73|Anopheles gambiae F1 protein protein. 23 8.6 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 27.1 bits (57), Expect = 0.70 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = +2 Query: 467 PKSSPGDVLNSFNSITQAMWSLLRIKIWTIMNSDQR 574 P ++ GD+ ++ ++T + S+ I++W + + QR Sbjct: 331 PLANDGDIRSAIGNVTGSASSIATIQLWQLSDGTQR 366 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 26.2 bits (55), Expect = 1.2 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 141 FQPELSSAYPTRAKWQVSTGPYFGGRIAVEAADGGPERAPY 263 F+ S +PT A + P+F GR+ A GGP P+ Sbjct: 201 FKGSWSIPFPTNATVE---RPFFTGRMHTAARYGGPRSVPF 238 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 25.4 bits (53), Expect = 2.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 278 CWDCLVWS 255 CWDC VWS Sbjct: 20 CWDCTVWS 27 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 25.4 bits (53), Expect = 2.1 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 329 DVN--ETTVATYVIVQENLPILTHSTRRFLVICT 424 DVN ET Y+ ++ PI + RF+V CT Sbjct: 413 DVNKVETVTDAYIKLELKSPIKRNKLMRFMVTCT 446 >Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. Length = 101 Score = 23.4 bits (48), Expect = 8.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 508 YHTGDVEPFENQDMDYNELRP 570 Y GDV ++ +D D L+P Sbjct: 25 YARGDVPTYDEEDFDEESLKP 45 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 8.6 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 124 CAHKRIFSPSYPVLTPRERSGKCRRDLILAVA 219 C ++I S SY P E GKC RD+IL +A Sbjct: 2408 CYMQQIQSSSY---IPLE--GKCERDIILQLA 2434 >AJ000038-1|CAA03874.1| 73|Anopheles gambiae F1 protein protein. Length = 73 Score = 23.4 bits (48), Expect = 8.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 508 YHTGDVEPFENQDMDYNELRP 570 Y GDV ++ +D D L+P Sbjct: 25 YARGDVPTYDEEDFDEESLKP 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 891,534 Number of Sequences: 2352 Number of extensions: 18786 Number of successful extensions: 41 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87734433 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -