BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= tesV0295.Seq
(825 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY584611-1|AAS91740.1| 2367|Homo sapiens GPR158-like 1 receptor ... 30 8.8
>AY584611-1|AAS91740.1| 2367|Homo sapiens GPR158-like 1 receptor
protein.
Length = 2367
Score = 30.3 bits (65), Expect = 8.8
Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%)
Frame = +3
Query: 111 RKSSLCPQEDFQPELSSAYPTRAK---WQVS 194
R + +CPQED +PE A P + + W+V+
Sbjct: 1568 RATQVCPQEDLRPEAQEATPAKTEICPWEVN 1598
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,950,480
Number of Sequences: 237096
Number of extensions: 2613806
Number of successful extensions: 6100
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5750
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6100
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10315140830
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -