BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0294.Seq (820 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 51 1e-06 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 49 4e-06 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 47 2e-05 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 47 2e-05 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 47 2e-05 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 46 3e-05 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 46 4e-05 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 46 4e-05 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 46 4e-05 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 46 4e-05 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 46 5e-05 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 45 6e-05 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 45 6e-05 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 45 6e-05 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 45 9e-05 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 45 9e-05 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 45 9e-05 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 45 9e-05 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 45 9e-05 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 45 9e-05 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 44 1e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 44 1e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 44 1e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 44 1e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 44 1e-04 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 44 1e-04 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 44 1e-04 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 44 1e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 44 1e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 44 1e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 44 1e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 44 1e-04 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 44 1e-04 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 44 1e-04 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 44 1e-04 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 44 1e-04 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 44 2e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 44 2e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 44 2e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 44 2e-04 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 44 2e-04 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 44 2e-04 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 44 2e-04 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 44 2e-04 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 44 2e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 43 3e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 43 3e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 43 3e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 43 3e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 43 3e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 43 3e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 43 3e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 43 3e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 43 3e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 43 3e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 43 3e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 43 3e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 43 3e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 43 3e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 43 3e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 43 3e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 43 3e-04 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 43 3e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 43 3e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 43 3e-04 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 43 3e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 43 3e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 43 3e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 43 3e-04 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 51.2 bits (117), Expect = 1e-06 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 2/70 (2%) Frame = -3 Query: 212 TRLRKCT-FRPSGWSSIHPVSRD-QQSNKTTDQSDATKLFHGHLWNTLSNLVPNSCSPGD 39 ++L C +P+ S+ + RD +Q + T Q ++ ++ H S + NSCSPGD Sbjct: 50 SKLSVCNGVKPTRQSTAAKLLRDAKQVKENTFQYNSREVLISHRQTNKSLKISNSCSPGD 109 Query: 38 PLVLERPPPR 9 PLVLERPPPR Sbjct: 110 PLVLERPPPR 119 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/62 (38%), Positives = 38/62 (61%) Frame = -3 Query: 194 TFRPSGWSSIHPVSRDQQSNKTTDQSDATKLFHGHLWNTLSNLVPNSCSPGDPLVLERPP 15 ++ SGWS+++ ++ + + + T + W+T ++ NSCSPGDPLVLERPP Sbjct: 64 SYNVSGWSTLYYMTSSYEVSGWSTLYYMTSSYGVSGWSTF--ILSNSCSPGDPLVLERPP 121 Query: 14 PR 9 PR Sbjct: 122 PR 123 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 L NTL+ + NSCSPGDPLVLERPPPR Sbjct: 2 LTNTLAQITSNSCSPGDPLVLERPPPR 28 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 NT ++LV NSCSPGDPLVLERPPPR Sbjct: 19 NTRAHLVSNSCSPGDPLVLERPPPR 43 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 NTL LV NSCSPGDPLVLERPPPR Sbjct: 4 NTLRILVSNSCSPGDPLVLERPPPR 28 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -3 Query: 92 HLWNTLSNLVPNSCSPGDPLVLERPPPR 9 +LW T +L+ NSCSPGDPLVLERPPPR Sbjct: 33 NLW-TFKHLISNSCSPGDPLVLERPPPR 59 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/50 (46%), Positives = 28/50 (56%) Frame = -3 Query: 158 VSRDQQSNKTTDQSDATKLFHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 V+R + + + D H SN + NSCSPGDPLVLERPPPR Sbjct: 32 VARGRTKTELFENDDVITQVHSSRLRHGSNFLSNSCSPGDPLVLERPPPR 81 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.2 bits (112), Expect = 4e-06 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N+V NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIVSNSCSPGDPLVLERPPPR 32 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 49.2 bits (112), Expect = 4e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 86 WNTLSNLVPNSCSPGDPLVLERPPPR 9 W L +L NSCSPGDPLVLERPPPR Sbjct: 9 WIDLKSLTSNSCSPGDPLVLERPPPR 34 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.8 bits (111), Expect = 5e-06 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N++ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIISNSCSPGDPLVLERPPPR 32 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.8 bits (111), Expect = 5e-06 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N++ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIISNSCSPGDPLVLERPPPR 32 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 48.4 bits (110), Expect = 7e-06 Identities = 22/36 (61%), Positives = 24/36 (66%), Gaps = 6/36 (16%) Frame = -3 Query: 98 HGHLWNTLSNLVP------NSCSPGDPLVLERPPPR 9 H W TL ++P NSCSPGDPLVLERPPPR Sbjct: 32 HRTFWKTLKKILPGEKKTSNSCSPGDPLVLERPPPR 67 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.0 bits (109), Expect = 9e-06 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N++ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANILSNSCSPGDPLVLERPPPR 32 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.0 bits (109), Expect = 9e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 L N++ NSCSPGDPLVLERPPPR Sbjct: 2 LHNVISNSCSPGDPLVLERPPPR 24 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N+ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIASNSCSPGDPLVLERPPPR 32 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 +W N NSCSPGDPLVLERPPPR Sbjct: 31 IWKNHKNYRSNSCSPGDPLVLERPPPR 57 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N+ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANITSNSCSPGDPLVLERPPPR 32 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/47 (53%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = -3 Query: 140 SNKTTDQSDATKLFHGHLWNTLSNLV---PNSCSPGDPLVLERPPPR 9 S+ T +D +L+ G L+ T V NSCSPGDPLVLERPPPR Sbjct: 2 SSLTKSSNDPRELYLGLLYPTEDYKVYPVSNSCSPGDPLVLERPPPR 48 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 113 ATKLFHGHLWNTLSNLVP-NSCSPGDPLVLERPPPR 9 + KL G +W LS P NSCSPGDPLVLERPPPR Sbjct: 3 SAKLNTGFVW-VLSFFSPSNSCSPGDPLVLERPPPR 37 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 L ++V NSCSPGDPLVLERPPPR Sbjct: 344 LHSIVSNSCSPGDPLVLERPPPR 366 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 L N NL NSCSPGDPLVLERPPPR Sbjct: 13 LSNPPKNLRSNSCSPGDPLVLERPPPR 39 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 +S L+ NSCSPGDPLVLERPPPR Sbjct: 14 ISFLISNSCSPGDPLVLERPPPR 36 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 SN+ NSCSPGDPLVLERPPPR Sbjct: 19 SNISSNSCSPGDPLVLERPPPR 40 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 LW + V NSCSPGDPLVLERPPPR Sbjct: 2 LWVRIPPGVSNSCSPGDPLVLERPPPR 28 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N+ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIPSNSCSPGDPLVLERPPPR 32 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N+ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIQSNSCSPGDPLVLERPPPR 32 >SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -3 Query: 95 GHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 G++WN + NSCSPGDPLVLERPPPR Sbjct: 18 GNMWNVEGS---NSCSPGDPLVLERPPPR 43 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/26 (84%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -3 Query: 83 NTLSNLVP-NSCSPGDPLVLERPPPR 9 NT S LV NSCSPGDPLVLERPPPR Sbjct: 14 NTQSKLVASNSCSPGDPLVLERPPPR 39 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 ++ + +V NSCSPGDPLVLERPPPR Sbjct: 20 VYTVIQKVVSNSCSPGDPLVLERPPPR 46 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N+ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIPSNSCSPGDPLVLERPPPR 32 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = -3 Query: 104 LFHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 + H +L +++ + NSCSPGDPLVLERPPPR Sbjct: 133 ILHCNLLFSINLITSNSCSPGDPLVLERPPPR 164 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 46.4 bits (105), Expect = 3e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 N ++ + NSCSPGDPLVLERPPPR Sbjct: 255 NPVTEYISNSCSPGDPLVLERPPPR 279 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.4 bits (105), Expect = 3e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 86 WNTLSNLVPNSCSPGDPLVLERPPPR 9 W + + + NSCSPGDPLVLERPPPR Sbjct: 6 WFDIKHDISNSCSPGDPLVLERPPPR 31 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -3 Query: 86 WNTLSNLVPNSCSPGDPLVLERPPPR 9 W S NSCSPGDPLVLERPPPR Sbjct: 7 WRLHSGKASNSCSPGDPLVLERPPPR 32 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N+ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIGSNSCSPGDPLVLERPPPR 32 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/28 (75%), Positives = 21/28 (75%), Gaps = 2/28 (7%) Frame = -3 Query: 86 WNTLSNLVP--NSCSPGDPLVLERPPPR 9 W NL P NSCSPGDPLVLERPPPR Sbjct: 55 WRLPGNLRPVSNSCSPGDPLVLERPPPR 82 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 L+NTL++ NSCSPGDPLVLERPPPR Sbjct: 2 LYNTLAS---NSCSPGDPLVLERPPPR 25 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 + LV NSCSPGDPLVLERPPPR Sbjct: 24 ARLVSNSCSPGDPLVLERPPPR 45 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N+ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIRSNSCSPGDPLVLERPPPR 32 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 1/28 (3%) Frame = -3 Query: 89 LWNTLS-NLVPNSCSPGDPLVLERPPPR 9 L +T+S +L+ NSCSPGDPLVLERPPPR Sbjct: 26 LRSTVSISLISNSCSPGDPLVLERPPPR 53 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.4 bits (105), Expect = 3e-05 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 ++N+ NSCSPGDPLVLERPPPR Sbjct: 13 ITNISSNSCSPGDPLVLERPPPR 35 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 N V NSCSPGDPLVLERPPPR Sbjct: 21 NAVSNSCSPGDPLVLERPPPR 41 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 46.4 bits (105), Expect = 3e-05 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -3 Query: 86 WNTLSNLVPNSCSPGDPLVLERPPPR 9 W ++ NSCSPGDPLVLERPPPR Sbjct: 14 WKYAIDIASNSCSPGDPLVLERPPPR 39 >SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTL--SNLVPNSCSPGDPLVLERPPPR 9 H +TL +N+ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIGSNSCSPGDPLVLERPPPR 32 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 LS NSCSPGDPLVLERPPPR Sbjct: 77 LSRFTSNSCSPGDPLVLERPPPR 99 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 N +S+ NSCSPGDPLVLERPPPR Sbjct: 12 NIVSHNTSNSCSPGDPLVLERPPPR 36 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 92 HLWNTLSNLVPNSCSPGDPLVLERPPPR 9 H W + + NSCSPGDPLVLERPPPR Sbjct: 38 HEWLSRVVVTSNSCSPGDPLVLERPPPR 65 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 LV NSCSPGDPLVLERPPPR Sbjct: 3 LVSNSCSPGDPLVLERPPPR 22 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 N+ NSCSPGDPLVLERPPPR Sbjct: 36 NIASNSCSPGDPLVLERPPPR 56 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 167 IHPVSRDQQ-SNKTTDQSDATKLFHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 +HP + + K+ D D + H L NSCSPGDPLVLERPPPR Sbjct: 449 VHPALIENRIDRKSQDALDRRRYIQAH--PILEAGASNSCSPGDPLVLERPPPR 500 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 36 DLISNSCSPGDPLVLERPPPR 56 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 LV NSCSPGDPLVLERPPPR Sbjct: 17 LVSNSCSPGDPLVLERPPPR 36 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 +N V NSCSPGDPLVLERPPPR Sbjct: 114 TNEVSNSCSPGDPLVLERPPPR 135 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 86 WNTLSNLVPNSCSPGDPLVLERPPPR 9 W + V NSCSPGDPLVLERPPPR Sbjct: 177 WIDWTRRVSNSCSPGDPLVLERPPPR 202 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 N+ S+ NSCSPGDPLVLERPPPR Sbjct: 19 NSNSHTASNSCSPGDPLVLERPPPR 43 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 ++ +V NSCSPGDPLVLERPPPR Sbjct: 74 VNTIVSNSCSPGDPLVLERPPPR 96 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = -3 Query: 173 SSIHPVSRDQQSNKTTDQSDATKLFHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 S I + + + ++ + + T+L G + + NSCSPGDPLVLERPPPR Sbjct: 445 SEISRLRAELKESQEQHRYEVTRLLQGEIAS--GQTTSNSCSPGDPLVLERPPPR 497 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/42 (57%), Positives = 28/42 (66%), Gaps = 6/42 (14%) Frame = -3 Query: 116 DATKLFH-GHLWNTLSN-----LVPNSCSPGDPLVLERPPPR 9 +AT +F GHL + L+ NSCSPGDPLVLERPPPR Sbjct: 2 NATLVFRCGHLTTNAATRVRFPLISNSCSPGDPLVLERPPPR 43 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 LV NSCSPGDPLVLERPPPR Sbjct: 5 LVSNSCSPGDPLVLERPPPR 24 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 LV NSCSPGDPLVLERPPPR Sbjct: 2 LVSNSCSPGDPLVLERPPPR 21 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 80 TLSNLVPNSCSPGDPLVLERPPPR 9 T S + NSCSPGDPLVLERPPPR Sbjct: 42 TESTITSNSCSPGDPLVLERPPPR 65 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -3 Query: 101 FHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 F+ + + + + V NSCSPGDPLVLERPPPR Sbjct: 2 FNCNFDSNMCSFVSNSCSPGDPLVLERPPPR 32 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 ++N + NSCSPGDPLVLERPPPR Sbjct: 4 ITNGISNSCSPGDPLVLERPPPR 26 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 86 WNTLSNLVPNSCSPGDPLVLERPPPR 9 W + V NSCSPGDPLVLERPPPR Sbjct: 10 WLKFVSKVSNSCSPGDPLVLERPPPR 35 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 LV NSCSPGDPLVLERPPPR Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 +++ V NSCSPGDPLVLERPPPR Sbjct: 13 IADFVSNSCSPGDPLVLERPPPR 35 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S L NSCSPGDPLVLERPPPR Sbjct: 9 SGLTSNSCSPGDPLVLERPPPR 30 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 30 SLISNSCSPGDPLVLERPPPR 50 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 N V NSCSPGDPLVLERPPPR Sbjct: 8 NSVSNSCSPGDPLVLERPPPR 28 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 L N L NSCSPGDPLVLERPPPR Sbjct: 2 LLNNLCYKTSNSCSPGDPLVLERPPPR 28 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S+ V NSCSPGDPLVLERPPPR Sbjct: 4 SDRVSNSCSPGDPLVLERPPPR 25 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 101 FHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 F GH N L NSCSPGDPLVLERPPPR Sbjct: 14 FTGHAKNDA--LSSNSCSPGDPLVLERPPPR 42 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 ++ +V NSCSPGDPLVLERPPPR Sbjct: 3471 VARVVSNSCSPGDPLVLERPPPR 3493 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L+ NSCSPGDPLVLERPPPR Sbjct: 8 LISNSCSPGDPLVLERPPPR 27 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 N L NSCSPGDPLVLERPPPR Sbjct: 1187 NDLKPFASNSCSPGDPLVLERPPPR 1211 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 N + +V NSCSPGDPLVLERPPPR Sbjct: 2 NMMIVVVSNSCSPGDPLVLERPPPR 26 >SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 N+ NSCSPGDPLVLERPPPR Sbjct: 6 NVTSNSCSPGDPLVLERPPPR 26 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L+ NSCSPGDPLVLERPPPR Sbjct: 70 LISNSCSPGDPLVLERPPPR 89 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -3 Query: 95 GHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 GH T + NSCSPGDPLVLERPPPR Sbjct: 2 GHSATTTTLTRSNSCSPGDPLVLERPPPR 30 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L+ NSCSPGDPLVLERPPPR Sbjct: 21 LISNSCSPGDPLVLERPPPR 40 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 5e-05 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 + ++ NSCSPGDPLVLERPPPR Sbjct: 1 MQTIISNSCSPGDPLVLERPPPR 23 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 LS + NSCSPGDPLVLERPPPR Sbjct: 15 LSRVSSNSCSPGDPLVLERPPPR 37 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L+ NSCSPGDPLVLERPPPR Sbjct: 16 LISNSCSPGDPLVLERPPPR 35 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 45.6 bits (103), Expect = 5e-05 Identities = 24/54 (44%), Positives = 34/54 (62%) Frame = -3 Query: 170 SIHPVSRDQQSNKTTDQSDATKLFHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 +I+ +S+D++ + S ++ GH + L NSCSPGDPLVLERPPPR Sbjct: 64 AINALSKDERIGERIIASIGPSIY-GHE-DIKRALASNSCSPGDPLVLERPPPR 115 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 L+N NSCSPGDPLVLERPPPR Sbjct: 16 LTNKSSNSCSPGDPLVLERPPPR 38 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 +N+ NSCSPGDPLVLERPPPR Sbjct: 39 ANVPSNSCSPGDPLVLERPPPR 60 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/56 (46%), Positives = 36/56 (64%) Frame = -3 Query: 176 WSSIHPVSRDQQSNKTTDQSDATKLFHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 +++I V+ +QS+ T+ KL G++ + V NSCSPGDPLVLERPPPR Sbjct: 5 FNTIGIVNYPKQSHHRTEGYIREKL-QGYIREFVLR-VSNSCSPGDPLVLERPPPR 58 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 +++L NSCSPGDPLVLERPPPR Sbjct: 1 MTSLSSNSCSPGDPLVLERPPPR 23 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 L+ L NSCSPGDPLVLERPPPR Sbjct: 2 LNLLASNSCSPGDPLVLERPPPR 24 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 +V NSCSPGDPLVLERPPPR Sbjct: 11 MVSNSCSPGDPLVLERPPPR 30 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 +V NSCSPGDPLVLERPPPR Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 N+ NSCSPGDPLVLERPPPR Sbjct: 33 NIPSNSCSPGDPLVLERPPPR 53 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 +V NSCSPGDPLVLERPPPR Sbjct: 85 IVSNSCSPGDPLVLERPPPR 104 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -3 Query: 86 WNTLSNLVPNSCSPGDPLVLERPPPR 9 WN NSCSPGDPLVLERPPPR Sbjct: 36 WNRQLLNASNSCSPGDPLVLERPPPR 61 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -3 Query: 80 TLSNLVPNSCSPGDPLVLERPPPR 9 T + ++ NSCSPGDPLVLERPPPR Sbjct: 13 TSAPVISNSCSPGDPLVLERPPPR 36 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 +V NSCSPGDPLVLERPPPR Sbjct: 6 IVSNSCSPGDPLVLERPPPR 25 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S L+ NSCSPGDPLVLERPPPR Sbjct: 5 SFLLSNSCSPGDPLVLERPPPR 26 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 +V NSCSPGDPLVLERPPPR Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S ++ NSCSPGDPLVLERPPPR Sbjct: 24 SLIISNSCSPGDPLVLERPPPR 45 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 L N ++ NSCSPGDPLVLERPPPR Sbjct: 5 LCNIANSHTSNSCSPGDPLVLERPPPR 31 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 9e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 ++ NSCSPGDPLVLERPPPR Sbjct: 17 IISNSCSPGDPLVLERPPPR 36 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/27 (74%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = -3 Query: 86 WNTLSNLVP-NSCSPGDPLVLERPPPR 9 W L V NSCSPGDPLVLERPPPR Sbjct: 104 WGRLKRSVESNSCSPGDPLVLERPPPR 130 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L+ NSCSPGDPLVLERPPPR Sbjct: 62 LLSNSCSPGDPLVLERPPPR 81 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 9e-05 Identities = 17/23 (73%), Positives = 21/23 (91%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 ++ ++ NSCSPGDPLVLERPPPR Sbjct: 9 ITKVLSNSCSPGDPLVLERPPPR 31 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 44.8 bits (101), Expect = 9e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 ++ NSCSPGDPLVLERPPPR Sbjct: 119 IISNSCSPGDPLVLERPPPR 138 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 44.8 bits (101), Expect = 9e-05 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = -3 Query: 122 QSDATKLFHGH-LWN-TLSNLVPNSCSPGDPLVLERPPPR 9 + + LF G LW+ LS NSCSPGDPLVLERPPPR Sbjct: 43 KGEGASLFSGTGLWSGALSQ--SNSCSPGDPLVLERPPPR 80 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 L ++ NSCSPGDPLVLERPPPR Sbjct: 52 LEPILSNSCSPGDPLVLERPPPR 74 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 9e-05 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 3/31 (9%) Frame = -3 Query: 92 HLWNTL--SNLV-PNSCSPGDPLVLERPPPR 9 H +TL +N+V NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIVISNSCSPGDPLVLERPPPR 33 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 N + NSCSPGDPLVLERPPPR Sbjct: 50 NDISNSCSPGDPLVLERPPPR 70 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -3 Query: 80 TLSNLVPNSCSPGDPLVLERPPPR 9 TL NSCSPGDPLVLERPPPR Sbjct: 16 TLQEKKSNSCSPGDPLVLERPPPR 39 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -3 Query: 92 HLWNTLSNLVPNSCSPGDPLVLERPPPR 9 HL++ L+ NSCSPGDPLVLERPPPR Sbjct: 15 HLYD-LALTTSNSCSPGDPLVLERPPPR 41 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 9e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 ++ NSCSPGDPLVLERPPPR Sbjct: 14 IISNSCSPGDPLVLERPPPR 33 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L+ NSCSPGDPLVLERPPPR Sbjct: 54 LLSNSCSPGDPLVLERPPPR 73 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L+ NSCSPGDPLVLERPPPR Sbjct: 2 LLSNSCSPGDPLVLERPPPR 21 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 ++ V NSCSPGDPLVLERPPPR Sbjct: 8 NDAVSNSCSPGDPLVLERPPPR 29 >SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 9e-05 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 3/31 (9%) Frame = -3 Query: 92 HLWNTL--SNLVP-NSCSPGDPLVLERPPPR 9 H +TL +N+V NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIVESNSCSPGDPLVLERPPPR 33 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -3 Query: 98 HGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 H H+ S + NSCSPGDPLVLERPPPR Sbjct: 22 HEHV-TICSYRISNSCSPGDPLVLERPPPR 50 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L+ NSCSPGDPLVLERPPPR Sbjct: 6 LLSNSCSPGDPLVLERPPPR 25 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 +V NSCSPGDPLVLERPPPR Sbjct: 19 VVSNSCSPGDPLVLERPPPR 38 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 9e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 ++ NSCSPGDPLVLERPPPR Sbjct: 5 IISNSCSPGDPLVLERPPPR 24 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S V NSCSPGDPLVLERPPPR Sbjct: 38 SENVSNSCSPGDPLVLERPPPR 59 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = +2 Query: 8 TAVAAALELVDPPGCRNSARGSTVYS 85 TAVAAALELVDPPGCRNS + YS Sbjct: 7 TAVAAALELVDPPGCRNSMNANVSYS 32 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 9e-05 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 3/31 (9%) Frame = -3 Query: 92 HLWNTL--SNL-VPNSCSPGDPLVLERPPPR 9 H +TL +N+ V NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANISVSNSCSPGDPLVLERPPPR 33 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 9e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 ++ NSCSPGDPLVLERPPPR Sbjct: 1 MISNSCSPGDPLVLERPPPR 20 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/32 (65%), Positives = 23/32 (71%), Gaps = 4/32 (12%) Frame = -3 Query: 92 HLWNTL----SNLVPNSCSPGDPLVLERPPPR 9 H NTL + + NSCSPGDPLVLERPPPR Sbjct: 25 HKLNTLFIPSTQMASNSCSPGDPLVLERPPPR 56 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L+ NSCSPGDPLVLERPPPR Sbjct: 1 LLSNSCSPGDPLVLERPPPR 20 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 1/21 (4%) Frame = -3 Query: 68 LVP-NSCSPGDPLVLERPPPR 9 LVP NSCSPGDPLVLERPPPR Sbjct: 27 LVPSNSCSPGDPLVLERPPPR 47 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 N + V NSCSPGDPLVLERPPPR Sbjct: 12 NIANAKVSNSCSPGDPLVLERPPPR 36 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 L T + NSCSPGDPLVLERPPPR Sbjct: 8 LLQTYQRVESNSCSPGDPLVLERPPPR 34 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 92 HLWNTLSNLVPNSCSPGDPLVLERPPPR 9 H+ + + NSCSPGDPLVLERPPPR Sbjct: 53 HMDEPTAKKLSNSCSPGDPLVLERPPPR 80 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = +2 Query: 8 TAVAAALELVDPPGCRNSARGSTVYSTSVREKVL 109 TAVAAALELVDPPGCRNS + + + +K+L Sbjct: 7 TAVAAALELVDPPGCRNSIKRTQQQLDDIHDKML 40 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 2 VSNSCSPGDPLVLERPPPR 20 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 15 LTSNSCSPGDPLVLERPPPR 34 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 92 HLWNTLSNLVPNSCSPGDPLVLERPPPR 9 H +TLSN SCSPGDPLVLERPPPR Sbjct: 3 HFTDTLSN----SCSPGDPLVLERPPPR 26 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 1066 VSNSCSPGDPLVLERPPPR 1084 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/30 (63%), Positives = 23/30 (76%), Gaps = 2/30 (6%) Frame = -3 Query: 92 HLWNTLSNLV--PNSCSPGDPLVLERPPPR 9 ++W+ L + NSCSPGDPLVLERPPPR Sbjct: 79 NIWDLLRPCIVTSNSCSPGDPLVLERPPPR 108 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 78 LTSNSCSPGDPLVLERPPPR 97 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S+ NSCSPGDPLVLERPPPR Sbjct: 63 SSTTSNSCSPGDPLVLERPPPR 84 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 214 VSNSCSPGDPLVLERPPPR 232 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 L + NSCSPGDPLVLERPPPR Sbjct: 15 LIKITSNSCSPGDPLVLERPPPR 37 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 N L NSCSPGDPLVLERPPPR Sbjct: 9 NASRTLRSNSCSPGDPLVLERPPPR 33 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 N+ + NSCSPGDPLVLERPPPR Sbjct: 146 NSRLEKISNSCSPGDPLVLERPPPR 170 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 5 VSNSCSPGDPLVLERPPPR 23 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 LS NSCSPGDPLVLERPPPR Sbjct: 3 LSYRTSNSCSPGDPLVLERPPPR 25 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 19 VSNSCSPGDPLVLERPPPR 37 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = -3 Query: 119 SDATKLFHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 SDA F ++ + NSCSPGDPLVLERPPPR Sbjct: 527 SDAFFPFRDNIDRAVQIQESNSCSPGDPLVLERPPPR 563 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 25 VSNSCSPGDPLVLERPPPR 43 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 89 LWNTLSNLVPNSCSPGDPLVLERPPPR 9 LW ++SN SCSPGDPLVLERPPPR Sbjct: 14 LWASISN----SCSPGDPLVLERPPPR 36 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 17 LASNSCSPGDPLVLERPPPR 36 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S + NSCSPGDPLVLERPPPR Sbjct: 2419 SAIASNSCSPGDPLVLERPPPR 2440 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 80 TLSNLVPNSCSPGDPLVLERPPPR 9 +L+ NSCSPGDPLVLERPPPR Sbjct: 30 SLATKTSNSCSPGDPLVLERPPPR 53 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 59 VSNSCSPGDPLVLERPPPR 77 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 31 VSNSCSPGDPLVLERPPPR 49 >SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S++ NSCSPGDPLVLERPPPR Sbjct: 2 SSIGSNSCSPGDPLVLERPPPR 23 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 N + NSCSPGDPLVLERPPPR Sbjct: 22 NNLSNSCSPGDPLVLERPPPR 42 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 6 VSNSCSPGDPLVLERPPPR 24 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/31 (67%), Positives = 25/31 (80%), Gaps = 3/31 (9%) Frame = -3 Query: 92 HLWNTL--SNLVP-NSCSPGDPLVLERPPPR 9 H +TL +N++ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIISSNSCSPGDPLVLERPPPR 33 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 37 LTSNSCSPGDPLVLERPPPR 56 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 20 LASNSCSPGDPLVLERPPPR 39 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 11 LTSNSCSPGDPLVLERPPPR 30 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 ++N NSCSPGDPLVLERPPPR Sbjct: 41 VANKPSNSCSPGDPLVLERPPPR 63 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 80 TLSNLVPNSCSPGDPLVLERPPPR 9 +LS NSCSPGDPLVLERPPPR Sbjct: 5 SLSLRASNSCSPGDPLVLERPPPR 28 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 88 LTSNSCSPGDPLVLERPPPR 107 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 8 VSNSCSPGDPLVLERPPPR 26 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 3 LASNSCSPGDPLVLERPPPR 22 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 661 LASNSCSPGDPLVLERPPPR 680 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 27 VSNSCSPGDPLVLERPPPR 45 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 7 LASNSCSPGDPLVLERPPPR 26 >SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 N+ NSCSPGDPLVLERPPPR Sbjct: 3 NVGSNSCSPGDPLVLERPPPR 23 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 193 VSNSCSPGDPLVLERPPPR 211 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 V NSCSPGDPLVLERPPPR Sbjct: 9 VSNSCSPGDPLVLERPPPR 27 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 92 HLWNTLSNLVPNSCSPGDPLVLERPPPR 9 H+ + + NSCSPGDPLVLERPPPR Sbjct: 21 HIQKKGAKEISNSCSPGDPLVLERPPPR 48 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 ++ NSCSPGDPLVLERPPPR Sbjct: 25 VISNSCSPGDPLVLERPPPR 44 >SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -3 Query: 107 KLFHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 K + +W LSN SCSPGDPLVLERPPPR Sbjct: 8 KFYSVSVWLALSN----SCSPGDPLVLERPPPR 36 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 L NSCSPGDPLVLERPPPR Sbjct: 4 LASNSCSPGDPLVLERPPPR 23 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 3/25 (12%) Frame = -3 Query: 74 SNLVP---NSCSPGDPLVLERPPPR 9 ++LVP NSCSPGDPLVLERPPPR Sbjct: 20 ASLVPRPSNSCSPGDPLVLERPPPR 44 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 L L NSCSPGDPLVLERPPPR Sbjct: 22 LQLLPSNSCSPGDPLVLERPPPR 44 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 92 HLWNTLSNLVPNSCSPGDPLVLERPPPR 9 H + L + NSCSPGDPLVLERPPPR Sbjct: 153 HRVSALPPHLSNSCSPGDPLVLERPPPR 180 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 80 TLSNLVPNSCSPGDPLVLERPPPR 9 T + NSCSPGDPLVLERPPPR Sbjct: 15 TRKKIPSNSCSPGDPLVLERPPPR 38 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S NSCSPGDPLVLERPPPR Sbjct: 17 SQTASNSCSPGDPLVLERPPPR 38 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 +++ NSCSPGDPLVLERPPPR Sbjct: 10 INSTASNSCSPGDPLVLERPPPR 32 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 59 ISNSCSPGDPLVLERPPPR 77 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 9 ISNSCSPGDPLVLERPPPR 27 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 3 ISNSCSPGDPLVLERPPPR 21 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 ++L + NSCSPGDPLVLERPPPR Sbjct: 5 SSLCVFLSNSCSPGDPLVLERPPPR 29 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 51 ISNSCSPGDPLVLERPPPR 69 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/55 (45%), Positives = 28/55 (50%) Frame = -3 Query: 173 SSIHPVSRDQQSNKTTDQSDATKLFHGHLWNTLSNLVPNSCSPGDPLVLERPPPR 9 S H RDQQ+ T + H + NSCSPGDPLVLERPPPR Sbjct: 40 SKYHTRERDQQTQLKTQIDTFILILQPHPRS-------NSCSPGDPLVLERPPPR 87 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -3 Query: 83 NTLSNLVPNSCSPGDPLVLERPPPR 9 N L NSCSPGDPLVLERPPPR Sbjct: 29 NAPLKLSSNSCSPGDPLVLERPPPR 53 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L NSCSPGDPLVLERPPPR Sbjct: 26 HLPSNSCSPGDPLVLERPPPR 46 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 + L NSCSPGDPLVLERPPPR Sbjct: 4 TGLPSNSCSPGDPLVLERPPPR 25 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 47 ISNSCSPGDPLVLERPPPR 65 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 + + NSCSPGDPLVLERPPPR Sbjct: 25 IPKIASNSCSPGDPLVLERPPPR 47 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 74 SNLVPNSCSPGDPLVLERPPPR 9 S+ NSCSPGDPLVLERPPPR Sbjct: 49 SSRASNSCSPGDPLVLERPPPR 70 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/33 (63%), Positives = 25/33 (75%), Gaps = 5/33 (15%) Frame = -3 Query: 92 HLWNTLSNLVP-----NSCSPGDPLVLERPPPR 9 HL N+ +++ P NSCSPGDPLVLERPPPR Sbjct: 26 HLPNSKTDINPRKPPSNSCSPGDPLVLERPPPR 58 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 L+ L NSCSPGDPLVLERPPPR Sbjct: 15 LTILGSNSCSPGDPLVLERPPPR 37 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -3 Query: 77 LSNLVPNSCSPGDPLVLERPPPR 9 + + NSCSPGDPLVLERPPPR Sbjct: 22 IMRITSNSCSPGDPLVLERPPPR 44 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +++ NSCSPGDPLVLERPPPR Sbjct: 22 HVLSNSCSPGDPLVLERPPPR 42 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 974 ISNSCSPGDPLVLERPPPR 992 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 6 ISNSCSPGDPLVLERPPPR 24 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 68 LVPNSCSPGDPLVLERPPPR 9 ++ NSCSPGDPLVLERPPPR Sbjct: 65 MLSNSCSPGDPLVLERPPPR 84 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 ++ NSCSPGDPLVLERPPPR Sbjct: 45 DIASNSCSPGDPLVLERPPPR 65 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/26 (84%), Positives = 22/26 (84%), Gaps = 2/26 (7%) Frame = -3 Query: 80 TLS-NLVP-NSCSPGDPLVLERPPPR 9 TLS VP NSCSPGDPLVLERPPPR Sbjct: 6 TLSLGFVPSNSCSPGDPLVLERPPPR 31 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 1 ISNSCSPGDPLVLERPPPR 19 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/28 (67%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = -3 Query: 89 LWNTLSNLVP-NSCSPGDPLVLERPPPR 9 LW ++ NSCSPGDPLVLERPPPR Sbjct: 2 LWAAYYKVITSNSCSPGDPLVLERPPPR 29 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -3 Query: 80 TLSNLVPNSCSPGDPLVLERPPPR 9 T+++ NSCSPGDPLVLERPPPR Sbjct: 55 TVTHRRSNSCSPGDPLVLERPPPR 78 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 65 VPNSCSPGDPLVLERPPPR 9 + NSCSPGDPLVLERPPPR Sbjct: 116 ISNSCSPGDPLVLERPPPR 134 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 71 NLVPNSCSPGDPLVLERPPPR 9 +L NSCSPGDPLVLERPPPR Sbjct: 5 SLSSNSCSPGDPLVLERPPPR 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,736,306 Number of Sequences: 59808 Number of extensions: 598009 Number of successful extensions: 3413 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3413 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -