BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0294.Seq (820 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.64 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.6 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 3.4 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 4.5 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 7.8 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 25.4 bits (53), Expect = 0.64 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 230 YFFYPHTRLRKCTFRPSGWSSIHPVSRDQQSNKTTDQS 117 Y Y HT +K S S P SRD+ + T ++ Sbjct: 67 YIKYSHTHEKKLVLERSKTKSKSPESRDRSNTSNTSKT 104 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.4 bits (48), Expect = 2.6 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 521 ARHAADQWR 495 ARHAAD+WR Sbjct: 861 ARHAADKWR 869 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 568 TLDHCKHIDEGHRKQYEDFV 627 TL H GHRK YE +V Sbjct: 154 TLHHGMAYHRGHRKDYERWV 173 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 22.6 bits (46), Expect = 4.5 Identities = 13/61 (21%), Positives = 25/61 (40%) Frame = -2 Query: 813 SNSSHSEQEKHAGWKKRSSPILGARIVMLPLLNRLIAANAFQRRSMMLTSDTDIKSNFIP 634 S S +H+G +SP M P ++ A + Q++ + + S+ +P Sbjct: 61 SPSPTGSSPQHSGSSASTSPAARTTSSMYPYVSAAAAHHHHQQQQAVAAAAFGATSSMVP 120 Query: 633 G 631 G Sbjct: 121 G 121 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.8 bits (44), Expect = 7.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 169 PFILSPVINNQTKRPTN 119 P +LSP +NN PT+ Sbjct: 194 PRVLSPPLNNNDATPTD 210 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,246 Number of Sequences: 438 Number of extensions: 5125 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26096055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -