BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0293.Seq (820 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) 163 2e-40 SB_17881| Best HMM Match : Tubulin (HMM E-Value=0) 162 4e-40 SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) 161 5e-40 SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.) 144 6e-35 SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) 85 5e-17 SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27) 79 4e-15 SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) 77 2e-14 SB_34400| Best HMM Match : Tubulin (HMM E-Value=0) 77 2e-14 SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 77 2e-14 SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) 77 2e-14 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 64 2e-10 SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) 56 3e-08 SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) 51 1e-06 SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) 42 6e-04 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25) 42 8e-04 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 42 8e-04 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 38 0.010 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.013 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 37 0.017 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 37 0.017 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 37 0.023 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 37 0.023 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 37 0.023 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 37 0.023 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 37 0.023 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 37 0.023 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.030 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 36 0.030 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 36 0.030 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 36 0.030 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 36 0.030 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 36 0.030 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 36 0.030 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 36 0.030 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 36 0.030 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 36 0.030 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 36 0.030 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 36 0.030 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 36 0.030 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 36 0.039 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 36 0.039 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 36 0.039 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 36 0.039 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 36 0.039 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.039 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 36 0.039 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.039 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.039 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 36 0.039 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 36 0.039 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 36 0.052 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 36 0.052 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.052 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 36 0.052 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 36 0.052 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.052 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 36 0.052 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 36 0.052 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.052 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.052 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.052 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.052 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.052 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 36 0.052 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.052 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.052 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 36 0.052 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.052 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 36 0.052 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 36 0.052 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 36 0.052 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 36 0.052 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 36 0.052 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 36 0.052 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 36 0.052 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 36 0.052 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 36 0.052 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 36 0.052 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 36 0.052 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 36 0.052 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.052 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 36 0.052 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 >SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 163 bits (395), Expect = 2e-40 Identities = 70/85 (82%), Positives = 79/85 (92%) Frame = +3 Query: 258 KFWEVISDEHGIDPSGCYHGDSDLQLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 KFWEVISDEHGIDP+G YHGDSDLQLERINVYYNEA+ GKYVPR+VLIDL+P TMD+VRS Sbjct: 19 KFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRSVLIDLEPGTMDSVRS 78 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 GPFG +FRPDNFV+GQ+ A NNWA+ Sbjct: 79 GPFGQIFRPDNFVFGQSGAGNNWAK 103 Score = 74.5 bits (175), Expect = 9e-14 Identities = 35/74 (47%), Positives = 45/74 (60%) Frame = +1 Query: 598 FQMSHXXXXXXXXXXXXXXVNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISW 777 FQ++H +++IREEYPDRI+ TFS+ PSP+VSD VVEPYN TL Sbjct: 133 FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSIVPSPKVSDTVVEPYNATLSVHQL 192 Query: 778 SRILIHTFCLDNEA 819 T+C+DNEA Sbjct: 193 VENTDETYCIDNEA 206 Score = 58.0 bits (134), Expect = 9e-09 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = +2 Query: 494 GQQLGKGHYTEGVEILESALDVIRREAEGCDCLQVFR 604 G KGHYTEG E+++S LDV+R+EAE CDC+Q F+ Sbjct: 98 GNNWAKGHYTEGAELMDSVLDVVRKEAESCDCIQGFQ 134 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +1 Query: 205 MREIINLQVGSCGNQIG 255 MREI++LQ G CGNQIG Sbjct: 1 MREIVSLQAGQCGNQIG 17 >SB_17881| Best HMM Match : Tubulin (HMM E-Value=0) Length = 458 Score = 162 bits (393), Expect = 4e-40 Identities = 69/85 (81%), Positives = 78/85 (91%) Frame = +3 Query: 258 KFWEVISDEHGIDPSGCYHGDSDLQLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 KFWEVISDEHGIDP+G YHGDSDLQLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRS Sbjct: 232 KFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRS 291 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 GPFG +FRPDNFV+GQ+ A NNWA+ Sbjct: 292 GPFGQIFRPDNFVFGQSGAGNNWAK 316 Score = 74.9 bits (176), Expect = 7e-14 Identities = 36/74 (48%), Positives = 45/74 (60%) Frame = +1 Query: 598 FQMSHXXXXXXXXXXXXXXVNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISW 777 FQ++H +++IREEYPDRI+ TFSV PSP+VSD VVEPYN TL Sbjct: 346 FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQL 405 Query: 778 SRILIHTFCLDNEA 819 T+C+DNEA Sbjct: 406 VENTDETYCIDNEA 419 Score = 58.4 bits (135), Expect = 6e-09 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +2 Query: 494 GQQLGKGHYTEGVEILESALDVIRREAEGCDCLQVFR 604 G KGHYTEG E+++S LDV+R+EAE CDCLQ F+ Sbjct: 311 GNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQ 347 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +1 Query: 202 KMREIINLQVGSCGNQIG 255 KMREI++ Q G CGNQIG Sbjct: 213 KMREIVHCQAGQCGNQIG 230 >SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 161 bits (392), Expect = 5e-40 Identities = 68/85 (80%), Positives = 78/85 (91%) Frame = +3 Query: 258 KFWEVISDEHGIDPSGCYHGDSDLQLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 KFWEVISDEHGIDP+G YHGDSDLQLERINVYYNEA+ GKYVPR +L+DL+P TMD+VRS Sbjct: 19 KFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRS 78 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 GPFG +FRPDNFV+GQ+ A NNWA+ Sbjct: 79 GPFGQIFRPDNFVFGQSGAGNNWAK 103 Score = 74.9 bits (176), Expect = 7e-14 Identities = 36/74 (48%), Positives = 45/74 (60%) Frame = +1 Query: 598 FQMSHXXXXXXXXXXXXXXVNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISW 777 FQ++H +++IREEYPDRI+ TFSV PSP+VSD VVEPYN TL Sbjct: 133 FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQL 192 Query: 778 SRILIHTFCLDNEA 819 T+C+DNEA Sbjct: 193 VENTDETYCIDNEA 206 Score = 58.4 bits (135), Expect = 6e-09 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +2 Query: 494 GQQLGKGHYTEGVEILESALDVIRREAEGCDCLQVFR 604 G KGHYTEG E+++S LDV+R+EAE CDCLQ F+ Sbjct: 98 GNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQ 134 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +1 Query: 205 MREIINLQVGSCGNQIG 255 MREI++ Q G CGNQIG Sbjct: 1 MREIVHCQAGQCGNQIG 17 >SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 144 bits (350), Expect = 6e-35 Identities = 61/74 (82%), Positives = 69/74 (93%) Frame = +3 Query: 258 KFWEVISDEHGIDPSGCYHGDSDLQLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 KFWEVISDEHGIDP+G YHGDSDLQLERINVYYNEA+ GKYVPR +L+DL+P TMD+VRS Sbjct: 19 KFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRS 78 Query: 438 GPFGCLFRPDNFVY 479 GPFG +FRPDNFV+ Sbjct: 79 GPFGQIFRPDNFVF 92 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +1 Query: 205 MREIINLQVGSCGNQIG 255 MREI++ Q G CGNQIG Sbjct: 1 MREIVHCQAGQCGNQIG 17 >SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) Length = 391 Score = 85.4 bits (202), Expect = 5e-17 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +3 Query: 372 GKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAR 512 GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA+ Sbjct: 2 GKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAK 48 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/74 (48%), Positives = 44/74 (59%) Frame = +1 Query: 598 FQMSHXXXXXXXXXXXXXXVNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISW 777 FQ++H + +IREEYPDRI+ TFSV PSP+VSD VVEPYN TL Sbjct: 78 FQLTHSLGGGTGSGMVTLLILKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQL 137 Query: 778 SRILIHTFCLDNEA 819 T+C+DNEA Sbjct: 138 VENTDETYCIDNEA 151 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = +2 Query: 494 GQQLGKGHYTEGVEILESALDVIRREAEGCDCLQVFR 604 G KGHYTEG E+++S LDV+R+EAE CDC+Q F+ Sbjct: 43 GNNWAKGHYTEGAELVDSVLDVVRKEAESCDCIQGFQ 79 >SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27) Length = 144 Score = 79.0 bits (186), Expect = 4e-15 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +3 Query: 366 SAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAR 512 + G+YVPR++L+DL+P TMDAVR GP G +FRPDNFV Q+ AANNWA+ Sbjct: 11 TGGRYVPRSILVDLEPGTMDAVRGGPLGNMFRPDNFVNSQSGAANNWAK 59 Score = 49.6 bits (113), Expect = 3e-06 Identities = 17/29 (58%), Positives = 25/29 (86%) Frame = +2 Query: 509 KGHYTEGVEILESALDVIRREAEGCDCLQ 595 KGHY+EG E++++ DV+R+EAE CDC+Q Sbjct: 59 KGHYSEGAELIDNIFDVLRKEAENCDCMQ 87 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRV 726 +++IREEYPDRI+ FSV PSP+V Sbjct: 108 LSKIREEYPDRILSAFSVVPSPKV 131 >SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) Length = 885 Score = 77.0 bits (181), Expect = 2e-14 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E AGK+VPR V +DL+P +D VR+ Sbjct: 21 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRT 80 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ V G+ AANN+AR Sbjct: 81 GTYRQLFHPEQLVTGKEDAANNYAR 105 Score = 76.6 bits (180), Expect = 2e-14 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E AGK+VPR V +DL+P +D VR+ Sbjct: 454 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRT 513 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 514 GTYRQLFHPEQLITGKEDAANNYAR 538 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P+VS VVEPYN+ L + + F +DNEA Sbjct: 154 MERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 208 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P+VS VVEPYN+ L + + F +DNEA Sbjct: 587 MERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 641 >SB_34400| Best HMM Match : Tubulin (HMM E-Value=0) Length = 380 Score = 76.6 bits (180), Expect = 2e-14 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E AGK+VPR V +DL+P +D VR+ Sbjct: 20 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRT 79 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 80 GTYRQLFHPEQLITGKEDAANNYAR 104 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P+VS VVEPYN+ L + + F +DNEA Sbjct: 153 MERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 207 >SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 76.6 bits (180), Expect = 2e-14 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E AGK+VPR V +DL+P+ +D +R+ Sbjct: 439 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPSVIDEIRT 498 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 499 GTYRQLFHPEQLITGKEDAANNYAR 523 Score = 74.9 bits (176), Expect = 7e-14 Identities = 35/85 (41%), Positives = 50/85 (58%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E AGK+VPR V DL+P +D VR+ Sbjct: 6 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFCDLEPTVVDEVRT 65 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 66 GTYRQLFHPEQLITGKEDAANNYAR 90 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P++S VVEPYN+ L + + F +DNEA Sbjct: 572 LERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSVLTTHTTLEHSDCAFMVDNEA 626 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P++S VVEPYN+ L + + F +DNEA Sbjct: 139 MERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 193 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 76.6 bits (180), Expect = 2e-14 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E AGK+VPR V +DL+P +D VR+ Sbjct: 85 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRT 144 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 145 GTYRQLFHPEQLITGKEDAANNYAR 169 Score = 76.6 bits (180), Expect = 2e-14 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E AGK+VPR V +DL+P +D VR+ Sbjct: 606 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRT 665 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 666 GTYRQLFHPEQLITGKEDAANNYAR 690 Score = 48.4 bits (110), Expect = 7e-06 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAV 431 WE+ EHGI P G D + + N +++E AGK+VPR V +DL+P + + Sbjct: 533 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVRECI 590 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P+VS VVEPYN+ L + + F +DNEA Sbjct: 739 MERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 793 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P++S VVEPYN+ L + + F +DNEA Sbjct: 218 MERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 272 >SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) Length = 451 Score = 76.6 bits (180), Expect = 2e-14 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E AGK+VPR V +DL+P +D VR+ Sbjct: 21 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRT 80 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 81 GTYRQLFHPEQLITGKEDAANNYAR 105 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P++S VVEPYN+ L + + F +DNEA Sbjct: 154 MERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 208 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 75.4 bits (177), Expect = 5e-14 Identities = 35/85 (41%), Positives = 50/85 (58%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N ++ E AGK+VPR V +DL+P +D VR+ Sbjct: 392 WELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFAETGAGKHVPRAVFVDLEPTVIDEVRT 451 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 452 GTYRQLFHPEQLITGKEDAANNYAR 476 Score = 74.9 bits (176), Expect = 7e-14 Identities = 35/85 (41%), Positives = 50/85 (58%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E AGK+VPR V DL+P +D VR+ Sbjct: 825 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFADLEPTVVDEVRT 884 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 885 GTYRQLFHPEQLITGKEDAANNYAR 909 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/55 (34%), Positives = 32/55 (58%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P +S VVEPYN+ L + + F +DNEA Sbjct: 525 MERLSVDYGKKSKLEFAIYPAPHISSAVVEPYNSILTTHTTLEHSDCAFMVDNEA 579 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P++S VVEPYN+ L + + F +DNEA Sbjct: 958 MERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 1012 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +2 Query: 437 GTLRMPIQTGQFRLRTKLCGQQLGKGHYTEGVEILESALDVIRREAEGCDCLQVF 601 GT R Q + +GHYT G E ++ LD +R+ A+GC LQ F Sbjct: 452 GTYRQLFHPEQLITGKEDAANNYARGHYTVGKEQIDIVLDRLRKLADGCTGLQGF 506 >SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 73.7 bits (173), Expect = 2e-13 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + + N +++E +GK+VPR V DL+P +D VR+ Sbjct: 21 WELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGSGKHVPRAVFCDLEPTVVDEVRT 80 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 G + LF P+ + G+ AANN+AR Sbjct: 81 GTYRQLFHPEQLITGKEDAANNYAR 105 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P++S VVEPYN+ L + + F +DNEA Sbjct: 154 MERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSVLTTHTTLEHSDCAFMVDNEA 208 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/55 (34%), Positives = 28/55 (50%) Frame = +2 Query: 437 GTLRMPIQTGQFRLRTKLCGQQLGKGHYTEGVEILESALDVIRREAEGCDCLQVF 601 GT R Q + +GHYT G E++++ LD +R+ A+GC LQ F Sbjct: 81 GTYRQLFHPEQLITGKEDAANNYARGHYTVGKEMIDTVLDRLRKLADGCTGLQGF 135 >SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 64.9 bits (151), Expect = 7e-11 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 2/76 (2%) Frame = +3 Query: 291 IDPSGCYHGDSDLQLERINV--YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRP 464 + PS + S + + I V +EA+AGKYVPR VL+DL+P +D VR+G + L+ P Sbjct: 941 VGPSPVQYQSSVVHCKEIGVGSKTSEAAAGKYVPRAVLVDLEPTVIDEVRTGMYRYLYHP 1000 Query: 465 DNFVYGQNCAANNWAR 512 + + G+ AANN+AR Sbjct: 1001 EQMISGKEDAANNYAR 1016 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +1 Query: 673 EYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 +Y + L F+V+P+P +S VVEPYN+ L + + TF +DNEA Sbjct: 1071 DYGKKSKLEFAVYPAPHISTAVVEPYNSVLTTHTTLEHSDCTFMVDNEA 1119 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 63.7 bits (148), Expect = 2e-10 Identities = 30/74 (40%), Positives = 41/74 (55%) Frame = +1 Query: 598 FQMSHXXXXXXXXXXXXXXVNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISW 777 FQ++H +++IREEYPDR++ +F V PSP VS+ V EPYN TL Sbjct: 41 FQIAHSLGGGTGSGLGSLLLSKIREEYPDRLVSSFCVLPSPLVSETVTEPYNATLSFHQL 100 Query: 778 SRILIHTFCLDNEA 819 + C+DNEA Sbjct: 101 VDVADAAICIDNEA 114 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 509 KGHYTEGVEILESALDVIRREAEGCDCLQVFR 604 KG YTEG E+++S +D IR+ AE CD +Q F+ Sbjct: 11 KGFYTEGAELMDSGMDCIRKLAENCDTVQGFQ 42 >SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 62.5 bits (145), Expect = 4e-10 Identities = 25/59 (42%), Positives = 39/59 (66%) Frame = +3 Query: 336 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAR 512 + N ++ E AGK+VPR V +DL+P +D +R+G + LF P+ + G+ AANN+AR Sbjct: 12 DSFNTFFAETGAGKHVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLLSGKEDAANNYAR 70 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+V+P+P++S VVEPYN+ L + + F +DNEA Sbjct: 119 MERLSVDYGKKSKLEFAVYPAPQISTAVVEPYNSILSTHTTLEHSDCAFMVDNEA 173 Score = 35.1 bits (77), Expect = 0.069 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +2 Query: 437 GTLRMPIQTGQFRLRTKLCGQQLGKGHYTEGVEILESALDVIRREAEGCDCLQVF 601 GT R Q + +GHYT G E ++ ALD IR+ A+ C LQ F Sbjct: 46 GTYRQLFHPEQLLSGKEDAANNYARGHYTVGKEHIDLALDRIRKLADQCTGLQGF 100 >SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 375 Score = 56.0 bits (129), Expect = 3e-08 Identities = 26/55 (47%), Positives = 33/55 (60%) Frame = +1 Query: 598 FQMSHXXXXXXXXXXXXXXVNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTL 762 FQ+ H + ++EEYPDRI+ + SVFPSPRVS+ VVEPYN L Sbjct: 14 FQLLHSLGGGTGSGLGTLILYHLQEEYPDRILSSVSVFPSPRVSEIVVEPYNAAL 68 >SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) Length = 536 Score = 51.2 bits (117), Expect = 1e-06 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 2/85 (2%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRS 437 WE+ EHGI P G D + N +++E AGK+VPR V +DL+P + Sbjct: 21 WELYCLEHGIQPDGQMPSDKTQGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVV----- 75 Query: 438 GPFGCLFRPDNFVYGQNCAANNWAR 512 P+ + G+ AANN+AR Sbjct: 76 -----ALSPEQLITGKEDAANNYAR 95 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/55 (34%), Positives = 32/55 (58%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+V+P+P ++ VVEPYN+ L + + F +DNEA Sbjct: 144 MERLSVDYGKKSKLEFAVYPAPHIASAVVEPYNSILTTHTTLEHSDCAFMVDNEA 198 >SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 48.4 bits (110), Expect = 7e-06 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 261 FWEVISDEHGIDPSG-CYHGDSDLQLERINVYYNE 362 FWEVI++EHGIDP G C S +Q +R+NVY++E Sbjct: 1 FWEVIAEEHGIDPDGQCTAVQSKIQTDRLNVYFDE 35 >SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQL--ERINVYYNEASAGKYVPRTVLIDLKPATMDAVR 434 WE+ EHGI P G D + + N +++E GK+VPR V +DL+P+ + ++ Sbjct: 21 WELYCLEHGIQPDGQMPSDKTIDGGDDSFNTFFSETGGGKHVPRAVFVDLEPSVVGRMK 79 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/55 (38%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y R L F+V+P+P++S VVEPYN+ L + + F +DNEA Sbjct: 285 MERLSVDYGKRSKLEFAVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 339 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +3 Query: 264 WEVISDEHGIDPSGCYHGDSDLQLER----INVYYNEASAGKY 380 WE+ EHGI P G H SD +R + +++E ++GK+ Sbjct: 216 WELYCLEHGIQPDG--HMPSDQSADRCDDSFSTFFSETASGKH 256 >SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) Length = 365 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+V+P+P++S VVEPYN+ L + + F +DNEA Sbjct: 79 MERLSVDYGKKSKLEFAVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 133 Score = 35.1 bits (77), Expect = 0.069 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +2 Query: 437 GTLRMPIQTGQFRLRTKLCGQQLGKGHYTEGVEILESALDVIRREAEGCDCLQVF 601 GT R Q + +GHYT G E ++ ALD IR+ A+ C LQ F Sbjct: 6 GTYRQLFHPEQLLSGKEDAANNYARGHYTVGKEHIDLALDRIRKLADQCTGLQGF 60 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 429 VRSGPFGCLFRPDNFVYGQNCAANNWAR 512 +R+G + LF P+ + G+ AANN+AR Sbjct: 3 IRTGTYRQLFHPEQLLSGKEDAANNYAR 30 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P++S VVEPYN+ L + + F +DNEA Sbjct: 91 MERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 145 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 423 DAVRSGPFGCLFRPDNFVYGQNCAANNWAR 512 D VR+G + LF P+ + G+ AANN+AR Sbjct: 13 DEVRTGTYRQLFHPEQLITGKEDAANNYAR 42 >SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25) Length = 139 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P++S VVEPYN+ L + + F +DNEA Sbjct: 29 MERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 83 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 655 VNRIREEYPDRIILTFSVFPSPRVSDCVVEPYNTTLRSISWSRILIHTFCLDNEA 819 + R+ +Y + L F+++P+P++S VVEPYN+ L + + F +DNEA Sbjct: 79 MERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEA 133 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 429 VRSGPFGCLFRPDNFVYGQNCAANNWAR 512 VR+G + LF P+ + G+ AANN+AR Sbjct: 3 VRTGTYRQLFHPEQLITGKEDAANNYAR 30 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 F L+ NSCSPGDPLVLERP Sbjct: 22 FPLISNSCSPGDPLVLERP 40 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T+V NSCSPGDPLVLERP Sbjct: 76 TIVSNSCSPGDPLVLERP 93 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 F ++ NSCSPGDPLVLERP Sbjct: 15 FRIISNSCSPGDPLVLERP 33 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 TL+ NSCSPGDPLVLERP Sbjct: 61 TLLSNSCSPGDPLVLERP 78 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 TL+ NSCSPGDPLVLERP Sbjct: 1 TLLSNSCSPGDPLVLERP 18 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T+V NSCSPGDPLVLERP Sbjct: 18 TVVSNSCSPGDPLVLERP 35 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T++ NSCSPGDPLVLERP Sbjct: 3 TIISNSCSPGDPLVLERP 20 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 TL NSCSPGDPLVLERP Sbjct: 5 TLASNSCSPGDPLVLERP 22 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 TL NSCSPGDPLVLERP Sbjct: 2 TLASNSCSPGDPLVLERP 19 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 24 LVSNSCSPGDPLVLERP 40 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 32 SLISNSCSPGDPLVLERP 49 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 3 LVSNSCSPGDPLVLERP 19 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 17 LVSNSCSPGDPLVLERP 33 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 9 LVSNSCSPGDPLVLERP 25 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 32 SLISNSCSPGDPLVLERP 49 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 32 SLISNSCSPGDPLVLERP 49 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 32 SLISNSCSPGDPLVLERP 49 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 5 LVSNSCSPGDPLVLERP 21 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 32 SLISNSCSPGDPLVLERP 49 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 32 SLISNSCSPGDPLVLERP 49 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 2 LVSNSCSPGDPLVLERP 18 >SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 +T NSCSPGDPLVLERP Sbjct: 2 YTFTSNSCSPGDPLVLERP 20 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 32 SLISNSCSPGDPLVLERP 49 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 26 LVSNSCSPGDPLVLERP 42 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T V NSCSPGDPLVLERP Sbjct: 8 TAVSNSCSPGDPLVLERP 25 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 33 SLISNSCSPGDPLVLERP 50 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 26 LVSNSCSPGDPLVLERP 42 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 32 SLISNSCSPGDPLVLERP 49 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L+ NSCSPGDPLVLERP Sbjct: 30 SLISNSCSPGDPLVLERP 47 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 ++V NSCSPGDPLVLERP Sbjct: 346 SIVSNSCSPGDPLVLERP 363 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 17 LISNSCSPGDPLVLERP 33 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 37 LISNSCSPGDPLVLERP 53 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 8 LISNSCSPGDPLVLERP 24 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T++ NSCSPGDPLVLERP Sbjct: 18 TVLSNSCSPGDPLVLERP 35 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T+ NSCSPGDPLVLERP Sbjct: 3 TIASNSCSPGDPLVLERP 20 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T+ NSCSPGDPLVLERP Sbjct: 45 TITSNSCSPGDPLVLERP 62 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 40 LISNSCSPGDPLVLERP 56 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 70 LISNSCSPGDPLVLERP 86 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 21 LISNSCSPGDPLVLERP 37 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 16 LISNSCSPGDPLVLERP 32 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 F L NSCSPGDPLVLERP Sbjct: 20 FLLPSNSCSPGDPLVLERP 38 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T + NSCSPGDPLVLERP Sbjct: 513 TFLSNSCSPGDPLVLERP 530 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 F + NSCSPGDPLVLERP Sbjct: 50 FRVASNSCSPGDPLVLERP 68 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 F + NSCSPGDPLVLERP Sbjct: 15 FRVTSNSCSPGDPLVLERP 33 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 TL NSCSPGDPLVLERP Sbjct: 13 TLRSNSCSPGDPLVLERP 30 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +1 Query: 4 SSTAVAGRSRTSGSPGLQEF 63 SST+ GRSRTSGSPGLQEF Sbjct: 99 SSTSGGGRSRTSGSPGLQEF 118 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 11 MVSNSCSPGDPLVLERP 27 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 85 IVSNSCSPGDPLVLERP 101 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 13 IVSNSCSPGDPLVLERP 29 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 6 IVSNSCSPGDPLVLERP 22 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T+ NSCSPGDPLVLERP Sbjct: 10 TISSNSCSPGDPLVLERP 27 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 119 IISNSCSPGDPLVLERP 135 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 3474 VVSNSCSPGDPLVLERP 3490 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 14 IISNSCSPGDPLVLERP 30 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 13 IISNSCSPGDPLVLERP 29 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 7 VVSNSCSPGDPLVLERP 23 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 54 LLSNSCSPGDPLVLERP 70 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 6 LLSNSCSPGDPLVLERP 22 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 FT NSCSPGDPLVLERP Sbjct: 11 FTDPSNSCSPGDPLVLERP 29 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 5 IISNSCSPGDPLVLERP 21 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/20 (85%), Positives = 17/20 (85%), Gaps = 1/20 (5%) Frame = -3 Query: 77 FTLVP-NSCSPGDPLVLERP 21 F VP NSCSPGDPLVLERP Sbjct: 42 FETVPSNSCSPGDPLVLERP 61 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 + V NSCSPGDPLVLERP Sbjct: 12 SFVSNSCSPGDPLVLERP 29 >SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 +T NSCSPGDPLVLERP Sbjct: 19 YTFGSNSCSPGDPLVLERP 37 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T+ NSCSPGDPLVLERP Sbjct: 22 TISSNSCSPGDPLVLERP 39 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T NSCSPGDPLVLERP Sbjct: 19 TFTSNSCSPGDPLVLERP 36 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 1 MISNSCSPGDPLVLERP 17 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 1 LLSNSCSPGDPLVLERP 17 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/18 (94%), Positives = 17/18 (94%), Gaps = 1/18 (5%) Frame = -3 Query: 71 LVP-NSCSPGDPLVLERP 21 LVP NSCSPGDPLVLERP Sbjct: 27 LVPSNSCSPGDPLVLERP 44 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 7 LLSNSCSPGDPLVLERP 23 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L NSCSPGDPLVLERP Sbjct: 14 SLTSNSCSPGDPLVLERP 31 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 27 VVSNSCSPGDPLVLERP 43 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 + V NSCSPGDPLVLERP Sbjct: 24 YCYVSNSCSPGDPLVLERP 42 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 F + NSCSPGDPLVLERP Sbjct: 33 FGFLSNSCSPGDPLVLERP 51 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 13 IISNSCSPGDPLVLERP 29 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 26 IISNSCSPGDPLVLERP 42 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T NSCSPGDPLVLERP Sbjct: 7 TTTSNSCSPGDPLVLERP 24 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 30 VSNSCSPGDPLVLERP 45 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 7 VSNSCSPGDPLVLERP 22 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 2 VSNSCSPGDPLVLERP 17 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 15 LTSNSCSPGDPLVLERP 31 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 40 VSNSCSPGDPLVLERP 55 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 117 VSNSCSPGDPLVLERP 132 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 184 VSNSCSPGDPLVLERP 199 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 34 VSNSCSPGDPLVLERP 49 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 F NSCSPGDPLVLERP Sbjct: 5 FQATSNSCSPGDPLVLERP 23 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 1066 VSNSCSPGDPLVLERP 1081 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 14 VISNSCSPGDPLVLERP 30 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 78 LTSNSCSPGDPLVLERP 94 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 23 AALELVDPPGCRNSARV*ICY 85 AALELVDPPGCRNS V C+ Sbjct: 68 AALELVDPPGCRNSITVFHCH 88 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 3 VSNSCSPGDPLVLERP 18 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 214 VSNSCSPGDPLVLERP 229 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 32 VSNSCSPGDPLVLERP 47 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 5 LASNSCSPGDPLVLERP 21 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 5 VSNSCSPGDPLVLERP 20 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 3 VSNSCSPGDPLVLERP 18 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 7 VSNSCSPGDPLVLERP 22 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 64 VSNSCSPGDPLVLERP 79 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 19 VSNSCSPGDPLVLERP 34 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 11 VSNSCSPGDPLVLERP 26 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 25 VSNSCSPGDPLVLERP 40 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 17 LASNSCSPGDPLVLERP 33 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 59 VSNSCSPGDPLVLERP 74 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 31 VSNSCSPGDPLVLERP 46 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +2 Query: 23 AALELVDPPGCRNSARV*ICYLTIFFLL 106 AALELVDPPGCRNS R +TIF ++ Sbjct: 11 AALELVDPPGCRNSIRS-TTTITIFTII 37 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 41 VSNSCSPGDPLVLERP 56 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 6 VSNSCSPGDPLVLERP 21 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 5 VISNSCSPGDPLVLERP 21 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 37 LTSNSCSPGDPLVLERP 53 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 18 VSNSCSPGDPLVLERP 33 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 20 LASNSCSPGDPLVLERP 36 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 11 LTSNSCSPGDPLVLERP 27 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 30 VSNSCSPGDPLVLERP 45 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 32 VSNSCSPGDPLVLERP 47 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 17 VSNSCSPGDPLVLERP 32 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 14 VSNSCSPGDPLVLERP 29 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 34 VSNSCSPGDPLVLERP 49 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 88 LTSNSCSPGDPLVLERP 104 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 11 LASNSCSPGDPLVLERP 27 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 17 VISNSCSPGDPLVLERP 33 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 8 VSNSCSPGDPLVLERP 23 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 23 VSNSCSPGDPLVLERP 38 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 18 VSNSCSPGDPLVLERP 33 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 11 LASNSCSPGDPLVLERP 27 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 661 LASNSCSPGDPLVLERP 677 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 + ++ NSCSPGDPLVLERP Sbjct: 10 YFILSNSCSPGDPLVLERP 28 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 7 LASNSCSPGDPLVLERP 23 >SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 F + NSCSPGDPLVLERP Sbjct: 2 FNVGSNSCSPGDPLVLERP 20 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 193 VSNSCSPGDPLVLERP 208 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 9 VSNSCSPGDPLVLERP 24 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 17 VSNSCSPGDPLVLERP 32 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 25 VISNSCSPGDPLVLERP 41 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 11 LTSNSCSPGDPLVLERP 27 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 F + NSCSPGDPLVLERP Sbjct: 2 FVVRSNSCSPGDPLVLERP 20 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 96 LASNSCSPGDPLVLERP 112 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 4 LASNSCSPGDPLVLERP 20 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 5 ISNSCSPGDPLVLERP 20 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 101 ISNSCSPGDPLVLERP 116 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 261 ISNSCSPGDPLVLERP 276 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 16 ISNSCSPGDPLVLERP 31 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 13 ILSNSCSPGDPLVLERP 29 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 21 ISNSCSPGDPLVLERP 36 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T+ NSCSPGDPLVLERP Sbjct: 9 TVGSNSCSPGDPLVLERP 26 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 59 ISNSCSPGDPLVLERP 74 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 9 ISNSCSPGDPLVLERP 24 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 10 ISNSCSPGDPLVLERP 25 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 3 ISNSCSPGDPLVLERP 18 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 55 ILSNSCSPGDPLVLERP 71 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 13 ISNSCSPGDPLVLERP 28 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 52 ISNSCSPGDPLVLERP 67 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 51 ISNSCSPGDPLVLERP 66 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L NSCSPGDPLVLERP Sbjct: 3 SLSSNSCSPGDPLVLERP 20 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 16 ISNSCSPGDPLVLERP 31 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 23 AALELVDPPGCRNSARV 73 AALELVDPPGCRNS +V Sbjct: 11 AALELVDPPGCRNSIKV 27 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 21 ISNSCSPGDPLVLERP 36 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 152 ISNSCSPGDPLVLERP 167 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 23 AALELVDPPGCRNSARV 73 AALELVDPPGCRNS +V Sbjct: 66 AALELVDPPGCRNSMKV 82 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 47 ISNSCSPGDPLVLERP 62 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 7 ISNSCSPGDPLVLERP 22 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T NSCSPGDPLVLERP Sbjct: 36 TSTSNSCSPGDPLVLERP 53 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 32 ISNSCSPGDPLVLERP 47 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 + + NSCSPGDPLVLERP Sbjct: 20 YEVTSNSCSPGDPLVLERP 38 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 18 ISNSCSPGDPLVLERP 33 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 32 ISNSCSPGDPLVLERP 47 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T NSCSPGDPLVLERP Sbjct: 33 TKTSNSCSPGDPLVLERP 50 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 974 ISNSCSPGDPLVLERP 989 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 6 ISNSCSPGDPLVLERP 21 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 65 MLSNSCSPGDPLVLERP 81 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 + + NSCSPGDPLVLERP Sbjct: 32 YNIPSNSCSPGDPLVLERP 50 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 1 ISNSCSPGDPLVLERP 16 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 5 ISNSCSPGDPLVLERP 20 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 32 ISNSCSPGDPLVLERP 47 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 116 ISNSCSPGDPLVLERP 131 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 +L NSCSPGDPLVLERP Sbjct: 5 SLSSNSCSPGDPLVLERP 22 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 2 ISNSCSPGDPLVLERP 17 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 2 ISNSCSPGDPLVLERP 17 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 14 ISNSCSPGDPLVLERP 29 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 2 ISNSCSPGDPLVLERP 17 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 8 ISNSCSPGDPLVLERP 23 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -3 Query: 77 FTLVPNSCSPGDPLVLERP 21 +++ NSCSPGDPLVLERP Sbjct: 5 WSVTSNSCSPGDPLVLERP 23 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 52 ISNSCSPGDPLVLERP 67 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 90 ISNSCSPGDPLVLERP 105 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 104 ILSNSCSPGDPLVLERP 120 >SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) Length = 138 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T NSCSPGDPLVLERP Sbjct: 12 TKTSNSCSPGDPLVLERP 29 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 7 ISNSCSPGDPLVLERP 22 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 6 ISNSCSPGDPLVLERP 21 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 68 ISNSCSPGDPLVLERP 83 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 30 ISNSCSPGDPLVLERP 45 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 46 ISNSCSPGDPLVLERP 61 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 45 ISNSCSPGDPLVLERP 60 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 18 SITSNSCSPGDPLVLERP 35 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 591 ISNSCSPGDPLVLERP 606 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 12 ISNSCSPGDPLVLERP 27 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 10 ISNSCSPGDPLVLERP 25 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 10 ISNSCSPGDPLVLERP 25 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.9 bits (79), Expect = 0.039 Identities = 17/21 (80%), Positives = 18/21 (85%), Gaps = 3/21 (14%) Frame = -3 Query: 74 TLVP---NSCSPGDPLVLERP 21 +LVP NSCSPGDPLVLERP Sbjct: 21 SLVPRPSNSCSPGDPLVLERP 41 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/19 (84%), Positives = 17/19 (89%), Gaps = 1/19 (5%) Frame = -3 Query: 74 TLVP-NSCSPGDPLVLERP 21 T+ P NSCSPGDPLVLERP Sbjct: 180 TIPPSNSCSPGDPLVLERP 198 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 13 IASNSCSPGDPLVLERP 29 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 25 LPSNSCSPGDPLVLERP 41 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 1 MASNSCSPGDPLVLERP 17 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 35.9 bits (79), Expect = 0.039 Identities = 17/20 (85%), Positives = 17/20 (85%), Gaps = 1/20 (5%) Frame = -3 Query: 77 FTLVP-NSCSPGDPLVLERP 21 F LV NSCSPGDPLVLERP Sbjct: 888 FPLVTSNSCSPGDPLVLERP 907 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 92 VLSNSCSPGDPLVLERP 108 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 37 IASNSCSPGDPLVLERP 53 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 23 LSSNSCSPGDPLVLERP 39 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 12 VLSNSCSPGDPLVLERP 28 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 15 VLSNSCSPGDPLVLERP 31 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 74 TLVPNSCSPGDPLVLERP 21 T NSCSPGDPLVLERP Sbjct: 14 TPTSNSCSPGDPLVLERP 31 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 71 LVPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 20 ITSNSCSPGDPLVLERP 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,735,909 Number of Sequences: 59808 Number of extensions: 536417 Number of successful extensions: 3232 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3203 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -