BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0292.Seq (827 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 0.32 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 23 2.2 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.2 bits (55), Expect = 0.32 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = -2 Query: 631 WPSRCTPCSASTCARCQTPTTRTSDTSACSRPWTAP*ATCCGHGEDVPAPTDV 473 W S T +T +T TTR + TS +RP T T G +P P V Sbjct: 1043 WSSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPT---QGTTIPPPAVV 1092 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/41 (21%), Positives = 17/41 (41%) Frame = -2 Query: 634 PWPSRCTPCSASTCARCQTPTTRTSDTSACSRPWTAP*ATC 512 P+P RC P +C + + ++ S +T +C Sbjct: 28 PYPPRCPPIYEPSCQYSPVSNSDSENSEVSSNSYTPKIKSC 68 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,833 Number of Sequences: 336 Number of extensions: 3117 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22725411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -