BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0291.Seq (848 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) 35 0.096 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 33 0.22 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 33 0.29 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 33 0.39 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 32 0.68 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 32 0.68 SB_18236| Best HMM Match : Histone (HMM E-Value=1.2) 32 0.68 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_12826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) 31 0.89 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_12724| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_37530| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_11742| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 31 1.2 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_13002| Best HMM Match : Ribonuc_2-5A (HMM E-Value=9.5) 31 1.2 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_48002| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 31 1.6 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 31 1.6 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) 31 1.6 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 30 2.1 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_56273| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55926| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 30 2.1 SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 30 2.1 SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) 30 2.1 SB_37859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_37362| Best HMM Match : zf-RNPHF (HMM E-Value=3) 30 2.1 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 30 2.1 SB_33473| Best HMM Match : GST_N (HMM E-Value=0.028) 30 2.1 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 30 2.1 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_30200| Best HMM Match : P_proprotein (HMM E-Value=0.011) 30 2.1 SB_28769| Best HMM Match : ig (HMM E-Value=1e-06) 30 2.1 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 30 2.1 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_25549| Best HMM Match : WD40 (HMM E-Value=0.25) 30 2.1 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_23182| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_20391| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 30 2.1 SB_16094| Best HMM Match : 7tm_1 (HMM E-Value=0.16) 30 2.1 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 30 2.1 SB_14180| Best HMM Match : ERp29_N (HMM E-Value=3.4) 30 2.1 SB_9745| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) 30 2.1 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 30 2.1 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_1082| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_526| Best HMM Match : GRP (HMM E-Value=8.5) 30 2.1 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 2.1 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 30 2.1 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 2.1 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 30 2.1 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_46001| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 30 2.1 SB_44654| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_35408| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 2.1 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_23268| Best HMM Match : HEAT (HMM E-Value=0.31) 30 2.1 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_13275| Best HMM Match : Phycoerythr_ab (HMM E-Value=0.23) 30 2.1 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 30 2.1 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_6658| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 30 2.7 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 30 2.7 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 30 2.7 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 30 2.7 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 30 2.7 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 30 2.7 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 30 2.7 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 29 3.6 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 29 3.6 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 29 3.6 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 29 3.6 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 29 3.6 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 29 3.6 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_20200| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 29 3.6 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 29 3.6 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 29 3.6 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 29 4.8 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 29 4.8 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 29 4.8 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 29 4.8 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 29 4.8 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 29 4.8 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 29 4.8 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 29 6.3 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 29 6.3 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 29 6.3 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 6.3 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 29 6.3 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 29 6.3 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 29 6.3 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 29 6.3 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 29 6.3 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 29 6.3 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 29 6.3 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 29 6.3 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 29 6.3 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 29 6.3 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 29 6.3 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 29 6.3 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 29 6.3 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 29 6.3 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 29 6.3 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 29 6.3 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 29 6.3 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 29 6.3 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 29 6.3 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 29 6.3 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 29 6.3 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 29 6.3 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 29 6.3 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 >SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) Length = 167 Score = 34.7 bits (76), Expect = 0.096 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSYQNQ 93 R GGRSRT SPG QEF + + Y N+ Sbjct: 7 RGGGRSRTSGSPGLQEFDQKHITEYSNR 34 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 FL+ NS PGD VLERPP R Sbjct: 16 FLISNSCSPGDPLVLERPPPR 36 >SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) Length = 220 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRK 72 R GGRSRT SPG QEF RK Sbjct: 7 RGGGRSRTSGSPGLQEFDMRK 27 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 FL+ NS PGD VLERPP R Sbjct: 20 FLISNSCSPGDPLVLERPPPR 40 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 FL+ NS PGD VLERPP R Sbjct: 15 FLISNSCSPGDPLVLERPPPR 35 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -1 Query: 80 EEFFLVPNSXXPGDXXVLERPPXR 9 EE+ + NS PGD VLERPP R Sbjct: 45 EEWIFLSNSCSPGDPLVLERPPPR 68 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.1 bits (72), Expect = 0.29 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSYQNQ 93 R GGRSRT SPG QEF T KN + ++ Sbjct: 7 RGGGRSRTSGSPGLQEFDT-KNQPFASK 33 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 86 W*EEFFLVPNSXXPGDXXVLERPPXR 9 W FF NS PGD VLERPP R Sbjct: 12 WVLSFFSPSNSCSPGDPLVLERPPPR 37 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 74 FFLVPNSXXPGDXXVLERPPXR 9 +F++ NS PGD VLERPP R Sbjct: 10 YFILSNSCSPGDPLVLERPPPR 31 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 32.7 bits (71), Expect = 0.39 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTR 69 R GGRSRT SPG QEF T+ Sbjct: 7 RGGGRSRTSGSPGLQEFDTK 26 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.7 bits (71), Expect = 0.39 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 FL+ NS PGD VLERPP R Sbjct: 6 FLLSNSCSPGDPLVLERPPPR 26 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.39 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 77 EFFLVPNSXXPGDXXVLERPPXR 9 E +L NS PGD VLERPP R Sbjct: 8 EVYLASNSCSPGDPLVLERPPPR 30 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -1 Query: 80 EEFFLVPNSXXPGDXXVLERPPXR 9 + F ++ NS PGD VLERPP R Sbjct: 13 QRFRIISNSCSPGDPLVLERPPPR 36 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 +L+ NS PGD VLERPP R Sbjct: 7 YLISNSCSPGDPLVLERPPPR 27 >SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 32.3 bits (70), Expect = 0.51 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKN 75 R GGRSRT SPG QEF + N Sbjct: 7 RGGGRSRTSGSPGLQEFDSNPN 28 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGT 66 R GGRSRT SPG QEF T Sbjct: 50 RGGGRSRTSGSPGLQEFDT 68 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 31.9 bits (69), Expect = 0.68 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F + NS PGD VLERPP R Sbjct: 45 FFISNSCSPGDPLVLERPPPR 65 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.68 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = -1 Query: 74 FFLVP---NSXXPGDXXVLERPPXR 9 F+L+P NS PGD VLERPP R Sbjct: 6 FYLIPMVSNSCSPGDPLVLERPPPR 30 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -1 Query: 74 FFLVPNSXXPGDXXVLERPPXR 9 F L+ NS PGD VLERPP R Sbjct: 22 FPLISNSCSPGDPLVLERPPPR 43 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 31.9 bits (69), Expect = 0.68 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F++ NS PGD VLERPP R Sbjct: 64 FMLSNSCSPGDPLVLERPPPR 84 >SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 74 FFLVPNSXXPGDXXVLERPPXR 9 FF NS PGD VLERPP R Sbjct: 4 FFHASNSCSPGDPLVLERPPPR 25 >SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGT 66 R GGRSRT SPG QEF T Sbjct: 7 RGGGRSRTSGSPGLQEFDT 25 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 31.9 bits (69), Expect = 0.68 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 89 FW*EEFFLVPNSXXPGDXXVLERPPXR 9 +W + NS PGD VLERPP R Sbjct: 35 YWNRQLLNASNSCSPGDPLVLERPPPR 61 >SB_18236| Best HMM Match : Histone (HMM E-Value=1.2) Length = 74 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSYQNQ 93 R GGRSRT SPG QEF ++ N+ Sbjct: 7 RGGGRSRTSGSPGLQEFDESSRLAHYNK 34 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 31.9 bits (69), Expect = 0.68 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F++ NS PGD VLERPP R Sbjct: 103 FILSNSCSPGDPLVLERPPPR 123 >SB_12826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 31.9 bits (69), Expect = 0.68 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSYQNQF 96 R GGRSRT SPG QEF K+ F Sbjct: 7 RGGGRSRTSGSPGLQEFDPTKDEKPDASF 35 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 LV NS PGD VLERPP R Sbjct: 24 LVSNSCSPGDPLVLERPPPR 43 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 LV NS PGD VLERPP R Sbjct: 3 LVSNSCSPGDPLVLERPPPR 22 >SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) Length = 160 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRK 72 R GGRSRT SPG QEF ++ Sbjct: 7 RGGGRSRTSGSPGLQEFDNKR 27 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 LV NS PGD VLERPP R Sbjct: 17 LVSNSCSPGDPLVLERPPPR 36 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 FL NS PGD VLERPP R Sbjct: 6 FLPSNSCSPGDPLVLERPPPR 26 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F V NS PGD VLERPP R Sbjct: 32 FKVSNSCSPGDPLVLERPPPR 52 >SB_12724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.5 bits (68), Expect = 0.89 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFG----TRKNSSYQNQF*QALSG 114 R GGRSRT SPG QEF TR++ + QF + +G Sbjct: 7 RGGGRSRTSGSPGLQEFDIIDLTRRDLAIWQQFTENWNG 45 >SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTR 69 R GGRSRT SPG QEF R Sbjct: 7 RGGGRSRTSGSPGLQEFDLR 26 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F V NS PGD VLERPP R Sbjct: 30 FRVSNSCSPGDPLVLERPPPR 50 >SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTR 69 R GGRSRT SPG QEF R Sbjct: 7 RGGGRSRTSGSPGLQEFDKR 26 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 LV NS PGD VLERPP R Sbjct: 9 LVSNSCSPGDPLVLERPPPR 28 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 LV NS PGD VLERPP R Sbjct: 5 LVSNSCSPGDPLVLERPPPR 24 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 LV NS PGD VLERPP R Sbjct: 2 LVSNSCSPGDPLVLERPPPR 21 >SB_37530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSYQN 90 R GGRSRT SPG QEF + +++ Sbjct: 7 RGGGRSRTSGSPGLQEFDAKSYDGHRD 33 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 LV NS PGD VLERPP R Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 LV NS PGD VLERPP R Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.5 bits (68), Expect = 0.89 Identities = 15/22 (68%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -1 Query: 71 FLVP-NSXXPGDXXVLERPPXR 9 FL+P NS PGD VLERPP R Sbjct: 20 FLLPSNSCSPGDPLVLERPPPR 41 >SB_11742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNS 78 R GGRSRT SPG QEF N+ Sbjct: 7 RGGGRSRTSGSPGLQEFDNDMNN 29 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 80 EEFFLVPNSXXPGDXXVLERPPXR 9 E F + NS PGD VLERPP R Sbjct: 48 EGFRVASNSCSPGDPLVLERPPPR 71 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSY 84 R GGRSRT SPG QEF + Y Sbjct: 7 RGGGRSRTSGSPGLQEFDASHCTQY 31 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 37 LISNSCSPGDPLVLERPPPR 56 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 77 EFFL-VPNSXXPGDXXVLERPPXR 9 EF L V NS PGD VLERPP R Sbjct: 35 EFVLRVSNSCSPGDPLVLERPPPR 58 >SB_13002| Best HMM Match : Ribonuc_2-5A (HMM E-Value=9.5) Length = 91 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTR 69 R GGRSRT SPG QEF R Sbjct: 7 RGGGRSRTSGSPGLQEFDHR 26 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 74 FFLVPNSXXPGDXXVLERPPXR 9 F+ NS PGD VLERPP R Sbjct: 9 FYSASNSCSPGDPLVLERPPPR 30 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F + NS PGD VLERPP R Sbjct: 30 FSISNSCSPGDPLVLERPPPR 50 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_48002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 4/31 (12%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF----GTRKNSSYQN 90 R GGRSRT SPG QEF GT +YQ+ Sbjct: 7 RGGGRSRTSGSPGLQEFDDATGTLSLRAYQS 37 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 77 EFFLVPNSXXPGDXXVLERPPXR 9 E+ NS PGD VLERPP R Sbjct: 15 EYLTASNSCSPGDPLVLERPPPR 37 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 40 LISNSCSPGDPLVLERPPPR 59 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 70 LISNSCSPGDPLVLERPPPR 89 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 34 LISNSCSPGDPLVLERPPPR 53 >SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSYQNQ 93 R GGRSRT SPG QEF + + +++ Sbjct: 7 RGGGRSRTSGSPGLQEFDVKHHQGTRDR 34 >SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSYQ 87 R GGRSRT SPG QEF +Y+ Sbjct: 7 RGGGRSRTSGSPGLQEFDDLVADAYE 32 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 31 LISNSCSPGDPLVLERPPPR 50 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 347 IVSNSCSPGDPLVLERPPPR 366 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 86 W*EEFFLVPNSXXPGDXXVLERPPXR 9 W + NS PGD VLERPP R Sbjct: 40 WLSRVVVTSNSCSPGDPLVLERPPPR 65 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSYQ 87 R GGRSRT SPG QEF + Q Sbjct: 7 RGGGRSRTSGSPGLQEFDLAASGGQQ 32 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEFGTRKNSSYQ 87 R GGRSRT SPG QEF + Q Sbjct: 7 RGGGRSRTSGSPGLQEFDDDEEKKVQ 32 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 77 IVSNSCSPGDPLVLERPPPR 96 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 89 FW*EEFFLVPNSXXPGDXXVLERPPXR 9 FW NS PGD VLERPP R Sbjct: 3 FWFGSGIRTSNSCSPGDPLVLERPPPR 29 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 77 EFFLVPNSXXPGDXXVLERPPXR 9 E + + NS PGD VLERPP R Sbjct: 9 ESYALSNSCSPGDPLVLERPPPR 31 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 77 EFFLVPNSXXPGDXXVLERPPXR 9 E + NS PGD VLERPP R Sbjct: 22 EVIITSNSCSPGDPLVLERPPPR 44 >SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) Length = 345 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -1 Query: 116 QPERAC*NWFW*EEFFLVPNSXXPGDXXVLERPPXR 9 +P+ N F F+ + NS PGD VLERPP R Sbjct: 204 RPKEISRNDFASTTFWGLSNSCSPGDPLVLERPPPR 239 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F V NS PGD VLERPP R Sbjct: 28 FGVSNSCSPGDPLVLERPPPR 48 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/26 (61%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -1 Query: 80 EEFFL--VPNSXXPGDXXVLERPPXR 9 EEF + V NS PGD VLERPP R Sbjct: 3 EEFRITAVSNSCSPGDPLVLERPPPR 28 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 85 IVSNSCSPGDPLVLERPPPR 104 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 13 IVSNSCSPGDPLVLERPPPR 32 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 6 IVSNSCSPGDPLVLERPPPR 25 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 + + NS PGD VLERPP R Sbjct: 5 YFISNSCSPGDPLVLERPPPR 25 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = -1 Query: 80 EEFFLVP---NSXXPGDXXVLERPPXR 9 E F ++P NS PGD VLERPP R Sbjct: 6 ENFGIIPKPSNSCSPGDPLVLERPPPR 32 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_56273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_55926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 446 RGGGRSRTSGSPGLQEF 462 >SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 62 LLSNSCSPGDPLVLERPPPR 81 >SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2653 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 2503 RGGGRSRTSGSPGLQEF 2519 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) Length = 166 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_37859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_37362| Best HMM Match : zf-RNPHF (HMM E-Value=3) Length = 88 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 63 RGGGRSRTSGSPGLQEF 79 >SB_33473| Best HMM Match : GST_N (HMM E-Value=0.028) Length = 276 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 74 RGGGRSRTSGSPGLQEF 90 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 119 IISNSCSPGDPLVLERPPPR 138 >SB_30200| Best HMM Match : P_proprotein (HMM E-Value=0.011) Length = 73 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_28769| Best HMM Match : ig (HMM E-Value=1e-06) Length = 213 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F NS PGD VLERPP R Sbjct: 36 FYTSNSCSPGDPLVLERPPPR 56 >SB_25549| Best HMM Match : WD40 (HMM E-Value=0.25) Length = 506 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 385 RGGGRSRTSGSPGLQEF 401 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -1 Query: 80 EEFFLVPNSXXPGDXXVLERPPXR 9 + F + NS PGD VLERPP R Sbjct: 13 KSFRVTSNSCSPGDPLVLERPPPR 36 >SB_23182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_20391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_16094| Best HMM Match : 7tm_1 (HMM E-Value=0.16) Length = 219 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_14180| Best HMM Match : ERp29_N (HMM E-Value=3.4) Length = 153 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_9745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) Length = 107 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 3474 VVSNSCSPGDPLVLERPPPR 3493 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_1082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_526| Best HMM Match : GRP (HMM E-Value=8.5) Length = 149 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 661 RGGGRSRTSGSPGLQEF 677 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 14 IISNSCSPGDPLVLERPPPR 33 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 13 IISNSCSPGDPLVLERPPPR 32 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 7 VVSNSCSPGDPLVLERPPPR 26 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 54 LLSNSCSPGDPLVLERPPPR 73 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 2 LLSNSCSPGDPLVLERPPPR 21 >SB_46001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 6 LLSNSCSPGDPLVLERPPPR 25 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_44654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 19 VVSNSCSPGDPLVLERPPPR 38 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 5 IISNSCSPGDPLVLERPPPR 24 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F+ NS PGD VLERPP R Sbjct: 11 FVPSNSCSPGDPLVLERPPPR 31 >SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_35408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 80 EEFFLVPNSXXPGDXXVLERPPXR 9 E L NS PGD VLERPP R Sbjct: 33 EHRVLTSNSCSPGDPLVLERPPPR 56 >SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F+ NS PGD VLERPP R Sbjct: 65 FIGSNSCSPGDPLVLERPPPR 85 >SB_23268| Best HMM Match : HEAT (HMM E-Value=0.31) Length = 154 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 1 MISNSCSPGDPLVLERPPPR 20 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGQQEF 23 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L+ NS PGD VLERPP R Sbjct: 1 LLSNSCSPGDPLVLERPPPR 20 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 4 IISNSCSPGDPLVLERPPPR 23 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/21 (71%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 68 LVP-NSXXPGDXXVLERPPXR 9 LVP NS PGD VLERPP R Sbjct: 27 LVPSNSCSPGDPLVLERPPPR 47 >SB_13275| Best HMM Match : Phycoerythr_ab (HMM E-Value=0.23) Length = 250 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 86 W*EEFFLVPNSXXPGDXXVLERPPXR 9 W + L NS PGD VLERPP R Sbjct: 9 WIDLKSLTSNSCSPGDPLVLERPPPR 34 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 +V NS PGD VLERPP R Sbjct: 27 VVSNSCSPGDPLVLERPPPR 46 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 13 IISNSCSPGDPLVLERPPPR 32 >SB_6658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 26 IISNSCSPGDPLVLERPPPR 45 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F + NS PGD VLERPP R Sbjct: 2 FGISNSCSPGDPLVLERPPPR 22 >SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F NS PGD VLERPP R Sbjct: 6 FYASNSCSPGDPLVLERPPPR 26 >SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 10 RXGGRSRTXXSPGXQEF 60 R GGRSRT SPG QEF Sbjct: 7 RGGGRSRTSGSPGLQEF 23 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 77 EFFLVPNSXXPGDXXVLERPPXR 9 E NS PGD VLERPP R Sbjct: 26 ELLTASNSCSPGDPLVLERPPPR 48 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 2 VSNSCSPGDPLVLERPPPR 20 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 15 LTSNSCSPGDPLVLERPPPR 34 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 117 VSNSCSPGDPLVLERPPPR 135 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 184 VSNSCSPGDPLVLERPPPR 202 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 1066 VSNSCSPGDPLVLERPPPR 1084 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 14 VISNSCSPGDPLVLERPPPR 33 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 78 LTSNSCSPGDPLVLERPPPR 97 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 214 VSNSCSPGDPLVLERPPPR 232 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 5 LASNSCSPGDPLVLERPPPR 24 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 5 VSNSCSPGDPLVLERPPPR 23 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 64 VSNSCSPGDPLVLERPPPR 82 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 6 LASNSCSPGDPLVLERPPPR 25 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 19 VSNSCSPGDPLVLERPPPR 37 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F NS PGD VLERPP R Sbjct: 15 FFQSNSCSPGDPLVLERPPPR 35 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -1 Query: 80 EEFFLVPNSXXPGDXXVLERPPXR 9 E ++ NS PGD VLERPP R Sbjct: 19 EVIHVLSNSCSPGDPLVLERPPPR 42 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 11 VSNSCSPGDPLVLERPPPR 29 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 25 VSNSCSPGDPLVLERPPPR 43 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 + + NS PGD VLERPP R Sbjct: 30 YRISNSCSPGDPLVLERPPPR 50 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 17 LASNSCSPGDPLVLERPPPR 36 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 59 VSNSCSPGDPLVLERPPPR 77 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 31 VSNSCSPGDPLVLERPPPR 49 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F + NS PGD VLERPP R Sbjct: 59 FELSNSCSPGDPLVLERPPPR 79 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 41 VSNSCSPGDPLVLERPPPR 59 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 6 VSNSCSPGDPLVLERPPPR 24 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 5 VISNSCSPGDPLVLERPPPR 24 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 20 LASNSCSPGDPLVLERPPPR 39 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 11 LTSNSCSPGDPLVLERPPPR 30 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 77 EFFLVPNSXXPGDXXVLERPPXR 9 E FL NS PGD VLERPP R Sbjct: 168 ELFL-SNSCSPGDPLVLERPPPR 189 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 17 VSNSCSPGDPLVLERPPPR 35 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 88 LTSNSCSPGDPLVLERPPPR 107 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 17 VISNSCSPGDPLVLERPPPR 36 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 8 VSNSCSPGDPLVLERPPPR 26 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 23 VSNSCSPGDPLVLERPPPR 41 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 3 LASNSCSPGDPLVLERPPPR 22 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 661 LASNSCSPGDPLVLERPPPR 680 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 27 VSNSCSPGDPLVLERPPPR 45 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 7 LASNSCSPGDPLVLERPPPR 26 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 74 FFLVPNSXXPGDXXVLERPPXR 9 F + NS PGD VLERPP R Sbjct: 33 FGFLSNSCSPGDPLVLERPPPR 54 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 193 VSNSCSPGDPLVLERPPPR 211 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 49 YVTSNSCSPGDPLVLERPPPR 69 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 9 VSNSCSPGDPLVLERPPPR 27 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 17 VSNSCSPGDPLVLERPPPR 35 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 25 VISNSCSPGDPLVLERPPPR 44 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 11 LTSNSCSPGDPLVLERPPPR 30 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 96 LASNSCSPGDPLVLERPPPR 115 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 L NS PGD VLERPP R Sbjct: 4 LASNSCSPGDPLVLERPPPR 23 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 V NS PGD VLERPP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -1 Query: 92 WFW*EEFFL--VPNSXXPGDXXVLERPPXR 9 +FW + F NS PGD VLERPP R Sbjct: 525 YFWRIKSFFGNASNSCSPGDPLVLERPPPR 554 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 + NS PGD VLERPP R Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 + NS PGD VLERPP R Sbjct: 101 ISNSCSPGDPLVLERPPPR 119 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 + NS PGD VLERPP R Sbjct: 261 ISNSCSPGDPLVLERPPPR 279 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 + NS PGD VLERPP R Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 F NS PGD VLERPP R Sbjct: 14 FFRSNSCSPGDPLVLERPPPR 34 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 71 FLVPNSXXPGDXXVLERPPXR 9 +++ NS PGD VLERPP R Sbjct: 91 WVLSNSCSPGDPLVLERPPPR 111 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 68 LVPNSXXPGDXXVLERPPXR 9 ++ NS PGD VLERPP R Sbjct: 13 ILSNSCSPGDPLVLERPPPR 32 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 + NS PGD VLERPP R Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 77 EFFLVPNSXXPGDXXVLERPPXR 9 + + NS PGD VLERPP R Sbjct: 17 KLLITSNSCSPGDPLVLERPPPR 39 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 + NS PGD VLERPP R Sbjct: 59 ISNSCSPGDPLVLERPPPR 77 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 65 VPNSXXPGDXXVLERPPXR 9 + NS PGD VLERPP R Sbjct: 9 ISNSCSPGDPLVLERPPPR 27 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,324,940 Number of Sequences: 59808 Number of extensions: 298655 Number of successful extensions: 2736 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2736 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -