BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0290.Seq (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_214| Best HMM Match : Arf (HMM E-Value=0) 130 1e-30 SB_53421| Best HMM Match : Arf (HMM E-Value=0) 68 7e-12 SB_11310| Best HMM Match : Arf (HMM E-Value=0) 67 1e-11 SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_56255| Best HMM Match : Arf (HMM E-Value=0) 64 1e-10 SB_57342| Best HMM Match : Arf (HMM E-Value=0) 62 6e-10 SB_37042| Best HMM Match : Arf (HMM E-Value=0) 57 1e-08 SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) 54 9e-08 SB_56254| Best HMM Match : Arf (HMM E-Value=5.3e-31) 54 2e-07 SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_7588| Best HMM Match : DcpS (HMM E-Value=0) 49 5e-06 SB_18358| Best HMM Match : Arf (HMM E-Value=0) 48 1e-05 SB_32972| Best HMM Match : Arf (HMM E-Value=2.66247e-44) 40 0.003 SB_977| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_51371| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) 32 0.57 SB_49453| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_8302| Best HMM Match : G-alpha (HMM E-Value=0) 32 0.57 SB_30236| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_38597| Best HMM Match : Arf (HMM E-Value=0.15) 30 2.3 SB_35858| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_14105| Best HMM Match : G-alpha (HMM E-Value=0) 29 3.0 SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_55304| Best HMM Match : Collagen (HMM E-Value=0.11) 29 4.0 SB_36756| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 29 4.0 SB_30255| Best HMM Match : Keratin_B2 (HMM E-Value=3.8) 29 5.3 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 28 7.0 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_50061| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_45859| Best HMM Match : RVT_1 (HMM E-Value=0.0014) 28 9.3 SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17) 28 9.3 SB_22668| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_20587| Best HMM Match : rve (HMM E-Value=7.2e-15) 28 9.3 SB_17286| Best HMM Match : RVT_1 (HMM E-Value=1.5e-05) 28 9.3 SB_14964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_13803| Best HMM Match : rve (HMM E-Value=8.6e-14) 28 9.3 SB_11841| Best HMM Match : Ras (HMM E-Value=0) 28 9.3 SB_1237| Best HMM Match : rve (HMM E-Value=0.00029) 28 9.3 SB_43452| Best HMM Match : RVT_1 (HMM E-Value=0.0056) 28 9.3 SB_34394| Best HMM Match : RVT_1 (HMM E-Value=8.7e-08) 28 9.3 SB_31861| Best HMM Match : rve (HMM E-Value=3.6e-07) 28 9.3 SB_31154| Best HMM Match : rve (HMM E-Value=2.5e-12) 28 9.3 SB_27735| Best HMM Match : Retrotrans_gag (HMM E-Value=0.097) 28 9.3 SB_20050| Best HMM Match : RVT_1 (HMM E-Value=1.3e-07) 28 9.3 SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_7198| Best HMM Match : rve (HMM E-Value=3.5e-14) 28 9.3 >SB_214| Best HMM Match : Arf (HMM E-Value=0) Length = 148 Score = 130 bits (314), Expect = 1e-30 Identities = 72/152 (47%), Positives = 92/152 (60%), Gaps = 3/152 (1%) Frame = +1 Query: 286 LAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLVDACDRPRLP 465 +AQHVPTLHPTSEELS+G MRFTTFDLGGH+QARR+W+DYFPAV+ IVF++D D RL Sbjct: 1 MAQHVPTLHPTSEELSMGGMRFTTFDLGGHRQARRIWKDYFPAVNGIVFIIDCADFERLA 60 Query: 466 ESKAELDSLLTDETPVTALC*FSATRLINPVLPVKTNYVTFSI-CISRPLEREKYQGPSF 642 ESK ELDSLL DE + ++ P V +Y+ + + + Sbjct: 61 ESKKELDSLLADEQLSSCPVLILGNKIDIPG-AVGEDYIRQNFGLFGQTTGKGSVAAKDL 119 Query: 643 PVGPLGAF--HVLGAEASGATAKGFRWLAQYI 732 P+ F VL E G +GFRWL++YI Sbjct: 120 ATRPMELFMCSVLKREGYG---EGFRWLSEYI 148 Score = 71.3 bits (167), Expect = 8e-13 Identities = 36/66 (54%), Positives = 42/66 (63%) Frame = +3 Query: 510 SNCPVLILGNKIDKPGAASEDELRHFFNLYQQTTGKGKVSRSELPGRAAGSFSCARC*SV 689 S+CPVLILGNKID PGA ED +R F L+ QTTGKG V+ +L R F C+ Sbjct: 76 SSCPVLILGNKIDIPGAVGEDYIRQNFGLFGQTTGKGSVAAKDLATRPMELFMCSVL-KR 134 Query: 690 RGYGEG 707 GYGEG Sbjct: 135 EGYGEG 140 >SB_53421| Best HMM Match : Arf (HMM E-Value=0) Length = 625 Score = 68.1 bits (159), Expect = 7e-12 Identities = 31/83 (37%), Positives = 50/83 (60%) Frame = +1 Query: 256 TLLHMLKDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFL 435 T+L+ LK + + VPTL E ++ ++ FT +D+GG + R +WR Y+ I+F+ Sbjct: 11 TILYRLKLEEVVSTVPTLGFNVETVTYKNISFTVWDIGGQDKIRALWRVYYQGCQGIIFV 70 Query: 436 VDACDRPRLPESKAELDSLLTDE 504 VD+ DR R E++ EL LL +E Sbjct: 71 VDSADRERAEEARNELHKLLAEE 93 >SB_11310| Best HMM Match : Arf (HMM E-Value=0) Length = 255 Score = 67.3 bits (157), Expect = 1e-11 Identities = 33/94 (35%), Positives = 54/94 (57%) Frame = +1 Query: 223 LVSGT*QCREETLLHMLKDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRD 402 L+ G + T+L+ LK D +PT+ E + +++FT +D+GG + R +WR Sbjct: 94 LMVGLDAAGKTTILYHLKLDEPVNTIPTIGFNVEVVEYKNIKFTVWDIGGQDKIRLLWRL 153 Query: 403 YFPAVDAIVFLVDACDRPRLPESKAELDSLLTDE 504 YF ++F+VD+ DR R+ E+K EL LL +E Sbjct: 154 YFQETQGLIFVVDSNDRDRIQEAKEELFKLLKEE 187 >SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 65.7 bits (153), Expect = 4e-11 Identities = 31/100 (31%), Positives = 57/100 (57%) Frame = +1 Query: 205 EKVGQALVSGT*QCREETLLHMLKDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQA 384 +K + L+ G + T+L+ LK + +PT+ E + ++ FT +D+GG + Sbjct: 15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEYKNISFTVWDVGGQDKI 74 Query: 385 RRVWRDYFPAVDAIVFLVDACDRPRLPESKAELDSLLTDE 504 R +WR YF ++++VD+ DR R+ ESK EL+ +L ++ Sbjct: 75 RPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQED 114 >SB_56255| Best HMM Match : Arf (HMM E-Value=0) Length = 181 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/100 (30%), Positives = 57/100 (57%) Frame = +1 Query: 205 EKVGQALVSGT*QCREETLLHMLKDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQA 384 +K + L+ G + T+L+ LK + +PT+ E + ++ FT +D+GG + Sbjct: 15 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74 Query: 385 RRVWRDYFPAVDAIVFLVDACDRPRLPESKAELDSLLTDE 504 R +WR YF ++F+VD+ DR R+ E++ EL+ +L ++ Sbjct: 75 RPLWRHYFQNTQGLIFVVDSNDRERVGEAREELNRMLNED 114 >SB_57342| Best HMM Match : Arf (HMM E-Value=0) Length = 457 Score = 61.7 bits (143), Expect = 6e-10 Identities = 30/84 (35%), Positives = 50/84 (59%), Gaps = 1/84 (1%) Frame = +1 Query: 247 REETLLHMLKDDRLAQHVPTLHPTSEELS-IGSMRFTTFDLGGHQQARRVWRDYFPAVDA 423 R+ T+L+ LK VPT+ E +S ++ F+ +D+GG + RR+WR YF + Sbjct: 121 RKTTILYKLKLKETVNTVPTVAFNVETISPCKNITFSVWDIGGQDKIRRLWRHYFQGAEG 180 Query: 424 IVFLVDACDRPRLPESKAELDSLL 495 I+F+VD+ D+ R+ E + EL +L Sbjct: 181 IIFVVDSADKERIFEVREELTRVL 204 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = +3 Query: 480 TRLVAH*RDASNCPVLILGNKIDKPGAASEDELRHFFNLYQQTTGKGKV 626 TR++ H + + PV+++ NK D GA D++ +LY+ T ++ Sbjct: 201 TRVLQH-SELNGVPVVVVANKQDLLGAIGPDKMAEELSLYKHTKNPWRI 248 >SB_37042| Best HMM Match : Arf (HMM E-Value=0) Length = 188 Score = 57.2 bits (132), Expect = 1e-08 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = +1 Query: 256 TLLHMLKDDRLAQHVPTLHPTSEELS-IGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVF 432 T+L+ LK +PT+ E L ++ T +D+GG + R +WR YF + ++F Sbjct: 34 TILYKLKLKETVSTIPTIGFNVETLQPTKNVTLTIWDVGGQDKIRPLWRHYFQGTEGLLF 93 Query: 433 LVDACDRPRLPESKAELDSLLTDE 504 +VD+ D R+PE+K EL +L + Sbjct: 94 VVDSSDVLRMPEAKEELHGVLDSD 117 >SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) Length = 260 Score = 54.4 bits (125), Expect = 9e-08 Identities = 31/110 (28%), Positives = 59/110 (53%), Gaps = 1/110 (0%) Frame = +1 Query: 169 LVHWSVGISWSMEKVGQALVSGT*QCREETLLHMLKDDRLAQH-VPTLHPTSEELSIGSM 345 ++ W + W E++ LV G + T ++++ + ++ +PT+ ++S G++ Sbjct: 8 ILDWFKSLFWK-EEMELTLV-GLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVSKGNV 65 Query: 346 RFTTFDLGGHQQARRVWRDYFPAVDAIVFLVDACDRPRLPESKAELDSLL 495 +D+GG + R +W Y V+ IV++VDA D +L SK EL +LL Sbjct: 66 TIKVWDIGGQPRFRSMWERYCRGVNCIVYMVDAADHDKLEASKNELHNLL 115 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 519 PVLILGNKIDKPGAASEDELRHFFNL 596 P+L+LGNK D P + E EL NL Sbjct: 124 PILVLGNKKDLPNSLDEKELVERLNL 149 >SB_56254| Best HMM Match : Arf (HMM E-Value=5.3e-31) Length = 650 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/61 (36%), Positives = 37/61 (60%) Frame = +1 Query: 322 EELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLVDACDRPRLPESKAELDSLLTD 501 E + ++ FT +D+GG + R +WR YF ++F+VD+ DR R E+K EL +L + Sbjct: 503 ETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERAGEAKEELSRMLAE 562 Query: 502 E 504 + Sbjct: 563 D 563 >SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/53 (37%), Positives = 34/53 (64%) Frame = +1 Query: 346 RFTTFDLGGHQQARRVWRDYFPAVDAIVFLVDACDRPRLPESKAELDSLLTDE 504 + +D+GG + R WR+YF + D ++++VD+ D+ RL + K EL LL +E Sbjct: 3 KLNIWDVGGQRSLRSYWRNYFESTDGLIWVVDSADQRRLADCKMELQGLLVEE 55 >SB_7588| Best HMM Match : DcpS (HMM E-Value=0) Length = 446 Score = 48.8 bits (111), Expect = 5e-06 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +1 Query: 361 DLGGHQQARRVWRDYFPAVDAIVFLVDACDRPRLPESKAELDSLLTD 501 D+GG + R +WR YF ++F+VD DR R+ E++ EL ++ D Sbjct: 143 DVGGQDKIRPLWRHYFAGSQGLIFVVDCADRDRIDEARKELQRIIND 189 >SB_18358| Best HMM Match : Arf (HMM E-Value=0) Length = 214 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +1 Query: 256 TLLHMLKDDRLAQHVPTLHPTSEELS-IGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVF 432 ++L+ K VPT E + +RF +D+GG +Q R +W+ Y DA+++ Sbjct: 36 SILYRNKFREYVNTVPTTAFNVETIRPFKGIRFKVWDIGGREQNRPLWKAYARQTDAVIY 95 Query: 433 LVDACDRPRLPESKAELDSLL 495 +VD+ +L E++ EL +LL Sbjct: 96 VVDSTSAGKLEEARDELFNLL 116 >SB_32972| Best HMM Match : Arf (HMM E-Value=2.66247e-44) Length = 257 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +1 Query: 370 GHQQARRVWRDYFPAVDAIVFLVDACDRPRLPESKAELDSLLTDE 504 G R WR Y+ DA++++VD+ D+ R+ SK EL ++L ++ Sbjct: 155 GQTSIRPYWRCYYANTDAVIYVVDSVDKDRIGISKQELLAMLEED 199 >SB_977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 274 KDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 438 + D L V T + + F FD+GG + R+ W F V AI+F V Sbjct: 171 EQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCV 225 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = +1 Query: 274 KDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLVDA 444 K D L T E I S+ F D+GG + R W F V +I+FLV + Sbjct: 383 KQDMLHSRKATKGIVEHEFMIKSIPFKMVDVGGQRSQRAKWFQCFDEVTSILFLVSS 439 >SB_51371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1325 Score = 32.3 bits (70), Expect = 0.43 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +1 Query: 223 LVSGT*QCREETLLHMLKDDRLAQHVPTLHPTSEEL-SIGSMRFTTFDLGGHQQARRVWR 399 L+ G + T+L L + + PT + + S G R +D+GG ++ R W+ Sbjct: 21 LLLGLDNSGKTTILKSLASEDVLHITPTQGFNIKSVQSKGGFRLNVWDIGGQRKIRPYWK 80 Query: 400 DYFPAVDAI 426 +YF D + Sbjct: 81 NYFENTDIL 89 >SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) Length = 259 Score = 31.9 bits (69), Expect = 0.57 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +1 Query: 340 SMRFTTFDLGGHQQARRVWRDYF 408 S++FT +D+GG Q+ R +WR Y+ Sbjct: 232 SLKFTIWDVGGLQKLRPLWRHYY 254 >SB_49453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1117 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +1 Query: 274 KDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 438 + D L V T + + F FD+GG + R+ W F V AI++ V Sbjct: 220 EQDLLRTRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCV 274 >SB_8302| Best HMM Match : G-alpha (HMM E-Value=0) Length = 315 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +1 Query: 274 KDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 438 + D L V T + + F FD+GG + R+ W F V AI++ V Sbjct: 172 EQDLLRTRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCV 226 >SB_30236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 31.5 bits (68), Expect = 0.76 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +1 Query: 274 KDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLVDACDR 453 + D L PT + ++ F D+GG + RR W F V +I+FLV + Sbjct: 170 EQDVLRARAPTSGIIEYPFDLETIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEY 229 Query: 454 PR-LPESKAE 480 + L ES +E Sbjct: 230 DQVLVESDSE 239 >SB_38597| Best HMM Match : Arf (HMM E-Value=0.15) Length = 188 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 352 TTFDLGGHQQARRVWRDYFPAV 417 T +DLGG + R +W+DY+ V Sbjct: 7 TVYDLGGGAKIRGIWKDYYAEV 28 >SB_35858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 29.5 bits (63), Expect = 3.0 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = +1 Query: 349 FTTFDLGG-HQQARRVWRDYFPAVDAIVFLVDACDRPRLPESKAELDSLLT-DETPV 513 FTTFDLGG ++ +WR + AI+ L + + E +LD L+T TPV Sbjct: 418 FTTFDLGGCMKELPLIWRSFSTESKAILPLCFL--KSQFLEEPVDLDELMTYSLTPV 472 >SB_14105| Best HMM Match : G-alpha (HMM E-Value=0) Length = 320 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 361 DLGGHQQARRVWRDYFPAVDAIVFLVDACDRPRLPESKAELDSLL 495 D+GG + R+ W +F V A+VF E + + +++L Sbjct: 168 DVGGQKNQRKKWIHFFDGVTAVVFFASLSSYDEQLEEEEDTNAML 212 >SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 501 RDASNCPVLILGNKIDKPGAASEDE 575 RD N P ++LGNK+D G A E Sbjct: 316 RDQDNFPFILLGNKVDVEGRAVSQE 340 >SB_55304| Best HMM Match : Collagen (HMM E-Value=0.11) Length = 853 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -2 Query: 698 VAPDASAPST*KAPSGPTGKLGP*YFSLSS 609 V D +APS APS PTG GP +LSS Sbjct: 69 VPSDPTAPSDPTAPSDPTGPTGPSDPTLSS 98 >SB_36756| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 638 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 448 DRPRLPESKAELDSLLT 498 + PRLPE+KA LD+LLT Sbjct: 294 EMPRLPEAKATLDTLLT 310 >SB_30255| Best HMM Match : Keratin_B2 (HMM E-Value=3.8) Length = 304 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQGSYWRLVSEQRV*FSLGLRQTW 454 + LHWQ RVY+ R+ A G R+ + V + + TW Sbjct: 154 IPLHWQKRVYEDLLRDEALGVVERVPYGEPVTWCHRMVVTW 194 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = +3 Query: 531 LGNKIDKPGAASEDELRHFFNLYQQTTGKGKVSRSELPGRAAGSFSCARC*SVRGYGEGL 710 LG+ ID+ S+ +RH +L ++ S LPGR++ + C +C + EG Sbjct: 110 LGSCIDEE--RSQSSVRHGPDLTEELAVHAVRLGSRLPGRSSNAVDCVQCAATAAGREGG 167 Query: 711 PLARAVH 731 H Sbjct: 168 DFVLCTH 174 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -3 Query: 490 TSLVQPWTPADVAGHTRRPGTLSRPPRGSSRATHDAPADAHRGRT 356 T+ + P P + RPG + PPR S P + RG + Sbjct: 1733 TTFIDPRLPVNTTDRRPRPGPETEPPRRSRAPPPRPPPPSSRGHS 1777 >SB_50061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1222 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 579 IPLHWQKRVYEDLLRDEALG 598 >SB_45859| Best HMM Match : RVT_1 (HMM E-Value=0.0014) Length = 471 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 272 IPLHWQKRVYEDLLRDEALG 291 >SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17) Length = 1590 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 620 IPLHWQKRVYEDLLRDEALG 639 >SB_22668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 176 IPLHWQKRVYEDLLRDEALG 195 >SB_20587| Best HMM Match : rve (HMM E-Value=7.2e-15) Length = 1485 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQGSYWRLVSEQRV*FSLGLRQTW 454 + LHWQ +VY R+ A G R+ + V + +R+T+ Sbjct: 726 IPLHWQQKVYDDLLRDEALGVIERVPYGEPVTWCHRMRETF 766 >SB_17286| Best HMM Match : RVT_1 (HMM E-Value=1.5e-05) Length = 288 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 25 IPLHWQKRVYEDLLRDEALG 44 >SB_14964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 593 IPLHWQKRVYEDLLRDEALG 612 >SB_13803| Best HMM Match : rve (HMM E-Value=8.6e-14) Length = 1447 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 588 IPLHWQKRVYEDLLRDEALG 607 >SB_11841| Best HMM Match : Ras (HMM E-Value=0) Length = 523 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +3 Query: 501 RDASNCPVLILGNKIDKP----GAASEDELRHFFNL-YQQTTGK 617 +DA P++++GNK D P + EL +N+ +Q+T+ K Sbjct: 330 KDAEEVPMVLVGNKCDLPQRTVSTSDAQELAKSYNIPFQETSAK 373 >SB_1237| Best HMM Match : rve (HMM E-Value=0.00029) Length = 1026 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 325 IPLHWQKRVYEDLLRDEALG 344 >SB_43452| Best HMM Match : RVT_1 (HMM E-Value=0.0056) Length = 437 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 131 IPLHWQKRVYEDLLRDEALG 150 >SB_34394| Best HMM Match : RVT_1 (HMM E-Value=8.7e-08) Length = 1201 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 622 IPLHWQKRVYEDLLRDEALG 641 >SB_31861| Best HMM Match : rve (HMM E-Value=3.6e-07) Length = 1253 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 608 IPLHWQKRVYEDLLRDEALG 627 >SB_31154| Best HMM Match : rve (HMM E-Value=2.5e-12) Length = 1067 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 546 IPLHWQKRVYEDLLRDEALG 565 >SB_27735| Best HMM Match : Retrotrans_gag (HMM E-Value=0.097) Length = 812 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 680 IPLHWQKRVYEDLLRDEALG 699 >SB_20050| Best HMM Match : RVT_1 (HMM E-Value=1.3e-07) Length = 493 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 177 IPLHWQKRVYEDLLRDEALG 196 >SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1552 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 603 IPLHWQKRVYEDLLRDEALG 622 >SB_7198| Best HMM Match : rve (HMM E-Value=3.5e-14) Length = 865 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 576 VRLHWQHRVYQSCCRESAQG 517 + LHWQ RVY+ R+ A G Sbjct: 69 IPLHWQKRVYEDLLRDEALG 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,669,770 Number of Sequences: 59808 Number of extensions: 465973 Number of successful extensions: 1514 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 1211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1504 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -