BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0285.Seq (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 27 0.63 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 4.5 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 27.1 bits (57), Expect = 0.63 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 403 SRSC-GKRHRLVQDACF*RRWCMKMRVRWFAEDGQLTNESARTRLWSIPDC 552 SRSC GKR +++ RW + RW ED + RT + ++P C Sbjct: 459 SRSCIGKRLAMMEMEVILARWIRQFEFRWNYEDYKF-----RTTVINMPGC 504 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.2 bits (50), Expect = 4.5 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 645 PQSLGSGSSLDVFAETRALEHHPIFSVVAGAAVGDG 538 P LG SSL E+ +EHH + + + G AVG G Sbjct: 648 PLPLGGSSSL---VES-LVEHHRLAASLGGGAVGGG 679 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 862,068 Number of Sequences: 2352 Number of extensions: 19445 Number of successful extensions: 48 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -