BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0284.Seq (763 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32780| Best HMM Match : SAICAR_synt (HMM E-Value=0) 107 7e-24 SB_21014| Best HMM Match : SAICAR_synt (HMM E-Value=2.2e-28) 107 7e-24 SB_13608| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_54973| Best HMM Match : RVP (HMM E-Value=2.6) 29 3.1 SB_48924| Best HMM Match : 7tm_2 (HMM E-Value=1.5e-16) 29 5.5 SB_17353| Best HMM Match : Transposase_11 (HMM E-Value=1.3) 29 5.5 SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_48647| Best HMM Match : Pencillinase_R (HMM E-Value=0.17) 28 9.5 SB_19442| Best HMM Match : Beach (HMM E-Value=0) 28 9.5 SB_647| Best HMM Match : Fork_head (HMM E-Value=3.5e-21) 28 9.5 SB_50868| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_32780| Best HMM Match : SAICAR_synt (HMM E-Value=0) Length = 278 Score = 107 bits (258), Expect = 7e-24 Identities = 47/84 (55%), Positives = 63/84 (75%), Gaps = 1/84 (1%) Frame = +1 Query: 259 HDPQWSEEQIISAKFNYNGLLIGRDEVDYMRKATILIFEILEKAWALRDCALIDMKIEFG 438 HDP W+ EQ + A F G IG+ E+D M ++ I IFEI+E+AWA D AL+DMKIEFG Sbjct: 134 HDPFWTYEQCVEAAFEIGGRKIGKHELDIMSESAIAIFEIIERAWATVDVALVDMKIEFG 193 Query: 439 VDTE-GSIVLADVIDSDSWRLWPS 507 V+ + G ++LADV+D+DSWR+WPS Sbjct: 194 VNRKTGELMLADVVDNDSWRIWPS 217 Score = 86.2 bits (204), Expect = 3e-17 Identities = 42/64 (65%), Positives = 47/64 (73%), Gaps = 2/64 (3%) Frame = +2 Query: 68 GIKTAFVKIASET--AFLSKKCEMIPIEWVTRRLATGSFLKRNPGVPEGFRFTPPKQETF 241 G+KT FVK AF+ CEMIP+E V RR+ATGSFLKR PGV EG+RFTPPKQE F Sbjct: 68 GLKTHFVKRCESDPEAFIGIACEMIPLEVVCRRIATGSFLKRYPGVKEGYRFTPPKQEFF 127 Query: 242 FKDD 253 KDD Sbjct: 128 LKDD 131 >SB_21014| Best HMM Match : SAICAR_synt (HMM E-Value=2.2e-28) Length = 265 Score = 107 bits (258), Expect = 7e-24 Identities = 47/84 (55%), Positives = 63/84 (75%), Gaps = 1/84 (1%) Frame = +1 Query: 259 HDPQWSEEQIISAKFNYNGLLIGRDEVDYMRKATILIFEILEKAWALRDCALIDMKIEFG 438 HDP W+ EQ + A F G IG+ E+D M ++ I IFEI+E+AWA D AL+DMKIEFG Sbjct: 44 HDPFWTYEQCVEAAFEIGGRKIGKHELDIMSESAIAIFEIIERAWATVDVALVDMKIEFG 103 Query: 439 VDTE-GSIVLADVIDSDSWRLWPS 507 V+ + G ++LADV+D+DSWR+WPS Sbjct: 104 VNRKTGELMLADVVDNDSWRIWPS 127 Score = 71.7 bits (168), Expect = 6e-13 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 131 MIPIEWVTRRLATGSFLKRNPGVPEGFRFTPPKQETFFKDD 253 MIP+E V RR+ATGSFLKR PGV EG+RFTPPKQE F KDD Sbjct: 1 MIPLEVVCRRIATGSFLKRYPGVKEGYRFTPPKQEFFLKDD 41 >SB_13608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -3 Query: 755 TRKFEHPSPKVPXATFSYFSDXVLGPAXDPHKXDXLCGEIVGFKKSXWSFTQ 600 T F+ P+P ATF+ ++GP D C +I FKK+ W+ Q Sbjct: 261 TLSFDDPNPMHIDATFN-----IIGPGLVLSNPDRPCHQIDMFKKAGWTVVQ 307 >SB_54973| Best HMM Match : RVP (HMM E-Value=2.6) Length = 255 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 188 NPGVPEGFRFTPPKQETFFKDDETTIPNGQRSKSFQPNSIITVF 319 NP + RF P ++ TFF D+ + G K F P ++ F Sbjct: 53 NPNLDNNDRFRPVRR-TFFSDEAIQVNEGPPRKCFPPTEVMFNF 95 >SB_48924| Best HMM Match : 7tm_2 (HMM E-Value=1.5e-16) Length = 736 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 586 NATLAWVKDQXDFLKPTISPQXLSXLW 666 NA L W+ DQ L + P LS LW Sbjct: 592 NADLCWITDQTALLSVFLGPIALSILW 618 >SB_17353| Best HMM Match : Transposase_11 (HMM E-Value=1.3) Length = 200 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 277 LTIGDRGFVILEERLLFWRSEPEAFWYTR 191 L + DRGF I E L+F+R+EP +TR Sbjct: 109 LVMADRGFTI-NESLMFYRAEPAIPAFTR 136 >SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 188 NPGVPEGFRFTPPKQETFFKDDETTIPNGQRSKSFQPNSII 310 NP + RF P + TFF D+ + G K F P ++ Sbjct: 319 NPNLDNNDRFRPVSR-TFFSDEVIQVDEGPPRKCFPPTEVM 358 >SB_48647| Best HMM Match : Pencillinase_R (HMM E-Value=0.17) Length = 1084 Score = 27.9 bits (59), Expect = 9.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 19 PCSDECLEPYKYNHHF 66 PC +E PYK N HF Sbjct: 845 PCKEEACAPYKQNEHF 860 >SB_19442| Best HMM Match : Beach (HMM E-Value=0) Length = 796 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 379 LEKAWALRDCALIDMKIEFGVDTEGSIVLADVIDSDSWRLWP 504 +++AW + D+K FGVD +G ++ D ++ SW P Sbjct: 111 VQRAWQNCNRDTSDVKFTFGVDDDGMVI--DDVELPSWANTP 150 >SB_647| Best HMM Match : Fork_head (HMM E-Value=3.5e-21) Length = 491 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 479 SMTSANTMLPSVSTPNSIFMSISAQ 405 S+TS M+P V P +++MS++A+ Sbjct: 183 SLTSGGAMMPVVVLPTNVYMSLAAK 207 >SB_50868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -2 Query: 534 VCHPLIFYHGRPQSPRVRIDDIRQYNATFCIDSEF 430 +C + HGRP PR R D+ A C+D F Sbjct: 346 LCELRLRLHGRPTGPRDRGTDV-YLRAKHCVDERF 379 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,179,931 Number of Sequences: 59808 Number of extensions: 486083 Number of successful extensions: 850 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -