BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0282.Seq (753 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55700.1 68414.m06378 DC1 domain-containing protein contains ... 31 0.82 At5g38280.1 68418.m04615 serine/threonine protein kinase (PR5K) ... 28 5.8 At4g39330.1 68417.m05568 mannitol dehydrogenase, putative nearly... 28 5.8 >At1g55700.1 68414.m06378 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 679 Score = 31.1 bits (67), Expect = 0.82 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 366 CPTSRNEANEVHLFCQTCDYD 428 C T ++ + HL C TCDYD Sbjct: 43 CRTKKHHRTKYHLHCDTCDYD 63 >At5g38280.1 68418.m04615 serine/threonine protein kinase (PR5K) identical to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 665 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -3 Query: 232 CRSFRGGTNKNSRC--RYGY*KDRCTADSR*TNTPNNSLVHCPSRIAQEAKRAQET 71 C+ TN + C Y Y D R +N+PN + CP+ I+ ++ ++ET Sbjct: 208 CQPTLYSTNFKNECPLAYSYAYDNENNTFRCSNSPNYVITFCPNDISSMSQPSKET 263 >At4g39330.1 68417.m05568 mannitol dehydrogenase, putative nearly identical to SP|P42734, probable mannitol dehydrogenase Length = 360 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -2 Query: 194 VSIRILKGSLHSGFTLDEHAQQFTGSLSFTNSARSKTGTRN 72 V + ++ GS S + D+ + + +SFT +A GT+N Sbjct: 94 VGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIGSDGTKN 134 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,252,186 Number of Sequences: 28952 Number of extensions: 264294 Number of successful extensions: 654 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -