Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesV0280.Seq
         (766 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Triboliu...    23   2.0  
U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I pr...    23   2.0  
U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II p...    22   4.7  
EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    22   4.7  

>X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Tribolium
           castaneum mRNAfor alhpa amylase 3'region. ).
          Length = 489

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 324 ILDRCERLLAPK 359
           I D CER LAPK
Sbjct: 40  IADECERFLAPK 51


>U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I
           protein.
          Length = 490

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 324 ILDRCERLLAPK 359
           I D CER LAPK
Sbjct: 41  IADECERFLAPK 52


>U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II
           protein.
          Length = 490

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 324 ILDRCERLLAPK 359
           I D CER LAPK
Sbjct: 41  IADVCERFLAPK 52


>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = +3

Query: 255 MPYSDRYSEKLSKLLRLKMNRKHILDRCERLL 350
           +P+    ++K    ++L + R  I+D CE L+
Sbjct: 336 VPFDLFENKKRKNNIKLYVRRVFIMDNCEELI 367


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,263
Number of Sequences: 336
Number of extensions: 2825
Number of successful extensions: 12
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20546262
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)