BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0279.Seq (753 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 32 0.005 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 29 0.062 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 25 1.0 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 2.3 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 23 3.1 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 23 3.1 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 22 7.1 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 22 7.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 7.1 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 7.1 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 32.3 bits (70), Expect = 0.005 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 668 HICIDTGFFHRDLKPENLLCCGPEXG 745 H C G HRDLKPENLL G Sbjct: 23 HHCHHNGVVHRDLKPENLLLASKAKG 48 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 28.7 bits (61), Expect = 0.062 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 482 IA*KTQPRQIVKLREVIRENDTLYFVFEYMAG 577 +A T+P +V+L + D LYFV EY+ G Sbjct: 38 LALSTKPPFLVQLHSCFQTMDRLYFVMEYVNG 69 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 24.6 bits (51), Expect = 1.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 674 CIDTGFFHRDLKPENLL 724 C + G H D+KP+N+L Sbjct: 171 CHNAGIVHADVKPKNIL 187 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 695 HRDLKPENLL 724 +RDLKPENLL Sbjct: 489 YRDLKPENLL 498 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 558 YLNIWRGNLYQLIR 599 +L+ WRGNL +IR Sbjct: 69 FLSYWRGNLANVIR 82 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 558 YLNIWRGNLYQLIR 599 +L+ WRGNL +IR Sbjct: 69 FLSYWRGNLANVIR 82 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 100 HHFQNTFKLIQTTYVK 53 +H QN FK+I++T K Sbjct: 57 NHIQNIFKIIKSTNEK 72 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 100 HHFQNTFKLIQTTYVK 53 +H QN FK+I++T K Sbjct: 40 NHIQNIFKIIKSTNEK 55 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = -2 Query: 233 DLN*SETLNKHLVAYFQYPLINNVTNLCLRRNYLEIVKDYLSLQAS 96 D+N ET+ + L Y+Q ++ V L ++++ KD + + + Sbjct: 508 DMN-YETMGRALRYYYQRGILAKVDGQRLVYQFVDVPKDIIEIDCT 552 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 612 HDRHPVSAGTDFPAIYSNTKYR 547 HD A FP++YS T+ R Sbjct: 183 HDASNFIAMETFPSVYSKTRRR 204 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,569 Number of Sequences: 438 Number of extensions: 4068 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -