BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0277.Seq (759 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1A4.01 |apc10|SPBC1E8.06|anaphase-promoting complex subunit ... 27 2.9 SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosacc... 27 2.9 SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription te... 25 8.9 >SPBC1A4.01 |apc10|SPBC1E8.06|anaphase-promoting complex subunit Apc10|Schizosaccharomyces pombe|chr 2|||Manual Length = 189 Score = 27.1 bits (57), Expect = 2.9 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = -1 Query: 297 DNERTARLDVEFLELRSNSSHDSHRINHVRRIRDFYADLRE 175 D R LDV ++++ ++H S + +HVR I+ + ++ + Sbjct: 127 DFGRNGLLDVHLIQIKILANHQSGKDSHVRLIKIYAPEIEQ 167 >SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1121 Score = 27.1 bits (57), Expect = 2.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 84 VINWDETKWNGMRWTHNVR 140 ++ D+T+WNGMR T VR Sbjct: 959 LLETDKTEWNGMRLTGEVR 977 >SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription termination factor Reb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 8.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 210 RRIRDFYADLRERRSHRTHREWYH 139 + IR FY++L ++ SHR + YH Sbjct: 278 KTIRMFYSNLYKKLSHRDAKSIYH 301 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,043,843 Number of Sequences: 5004 Number of extensions: 61038 Number of successful extensions: 142 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -