BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0276.Seq (797 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 36 0.002 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.0 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 35.5 bits (78), Expect = 0.002 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 9/82 (10%) Frame = +3 Query: 279 DPEQIKEINNYYDIETTVTVEFDTGQAYRDFVAGPYFRNRIEDQITESYRPTRSPA---- 446 DP++ ++ N+ +TT+ +E TGQ R F+ F N I++++ ESY PT A Sbjct: 241 DPKEAEDTNDKTSKKTTL-MEV-TGQYERTFIT---FENDIDNKLFESYFPTPDAARKHR 295 Query: 447 -----TTVPSAYDDPDPQLYFR 497 T +P+ Y DP QL +R Sbjct: 296 QICAVTRLPARYYDPITQLPYR 317 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.4 bits (53), Expect = 2.0 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +3 Query: 342 FDTGQAYRDFVAGPYFRNRIEDQ--ITESYRPTRSPATTVPSAYDDPDPQLYFRQGK 506 FD G+ +RD V P++RNR + Q SP +T P + + Y R+ K Sbjct: 1018 FDVGK-FRDAVVMPWYRNRDQPQYFYVAEICNHLSPKSTFPGSNYATFEEYYHRKYK 1073 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 751,198 Number of Sequences: 2352 Number of extensions: 14339 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -