BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0276.Seq (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69280.1 68414.m07943 expressed protein 31 1.2 At3g48670.2 68416.m05314 XH/XS domain-containing protein / XS zi... 29 3.6 At3g48670.1 68416.m05313 XH/XS domain-containing protein / XS zi... 29 3.6 At1g10490.1 68414.m01181 expressed protein contains Pfam profile... 29 4.7 At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR... 28 6.2 At2g36420.1 68415.m04471 expressed protein 28 8.3 At2g17430.1 68415.m02011 seven transmembrane MLO family protein ... 28 8.3 >At1g69280.1 68414.m07943 expressed protein Length = 400 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = -3 Query: 633 PCLGCCLRFSCYFGSSCHSGRLCLSWMQWLRW 538 PC CC SC + C C W RW Sbjct: 310 PCFSCCRLPSCGYNFFCCKRLKCCPCFSWCRW 341 >At3g48670.2 68416.m05314 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 647 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 210 DSESSGSAGCQRRPEQIFSKRNIDPEQIKEINNYYDIETTVTVEFD 347 D S+G +G + R E I R +P +++ + NY T VEF+ Sbjct: 145 DGRSAGESGSKLRDEYIL--RGFNPTRVRPLWNYLGHSGTAIVEFN 188 >At3g48670.1 68416.m05313 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 647 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 210 DSESSGSAGCQRRPEQIFSKRNIDPEQIKEINNYYDIETTVTVEFD 347 D S+G +G + R E I R +P +++ + NY T VEF+ Sbjct: 145 DGRSAGESGSKLRDEYIL--RGFNPTRVRPLWNYLGHSGTAIVEFN 188 >At1g10490.1 68414.m01181 expressed protein contains Pfam profile PF05127: Putative ATPase (DUF699) Length = 1028 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +1 Query: 145 PVTSTISEGLTKAKSYNDNDLRTLNPREVRDVKDALNRYFRRGTLI 282 P++S I + +TK + D++ + R+++ +KDALN F G LI Sbjct: 207 PLSSHI-KSITKVPTKEDSEALSEAERDLKSLKDALNDDFPVGPLI 251 >At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1544 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/79 (26%), Positives = 31/79 (39%) Frame = -3 Query: 417 PLFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRCRNNCLSP*FAPDQCSSSKISVQGVFD 238 P+ LR + V + L+P ++ QW C L P F Q S +S G+ Sbjct: 760 PMTKLRLLQINNVELEGNLKLLPSELKWIQWKGCPLENLPPDFLARQLSVLDLSESGIRQ 819 Query: 237 IPHFPRIQSPEVIVVVALR 181 + E + VV LR Sbjct: 820 VQTLRNKMVDENLKVVILR 838 >At2g36420.1 68415.m04471 expressed protein Length = 439 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 501 PVENTAEDPGHHKHSAQWSPENGSVCSFPL 412 P+E ED HH+H P N CSF + Sbjct: 258 PLEEEEEDEDHHQHEP--DPPNNLSCSFEI 285 >At2g17430.1 68415.m02011 seven transmembrane MLO family protein / MLO-like protein 7 (MLO7) identical to membrane protein Mlo7 [Arabidopsis thaliana] gi|14091584|gb|AAK53800; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley] Length = 542 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -2 Query: 784 GFVTXLSKEGXPAFKKVCCPRFGKVGELP-LEACNLLFER 668 GF++ L G P K+C PR + LP L +LF++ Sbjct: 89 GFISLLLTFGEPYILKICVPRKAALSMLPCLSEDTVLFQK 128 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,611,024 Number of Sequences: 28952 Number of extensions: 305209 Number of successful extensions: 818 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -