BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0274.Seq (789 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1025 - 10506144-10506226,10506643-10506699,10507502-105076... 32 0.60 03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624... 29 5.6 01_06_1640 + 38836977-38836988,38837694-38838047,38838164-388382... 29 5.6 07_01_0493 - 3715677-3715907,3716675-3716861,3717631-3717818 28 7.4 02_03_0412 - 18749430-18749587,18749696-18749857,18750062-187501... 28 7.4 11_02_0032 + 7564153-7564719,7564844-7565128,7565207-7565524,756... 28 9.7 >12_01_1025 - 10506144-10506226,10506643-10506699,10507502-10507605, 10507884-10507937,10508107-10508193,10509027-10509214, 10509793-10509854,10510084-10510354,10510756-10510834, 10511715-10511913,10512816-10512960,10513324-10513416, 10514449-10514736 Length = 569 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 369 ETFYKTACFARVHLNQGQFLYAF-YIAVIQRSDCHGF 476 ETF+ TAC R HL QG+ + A+ Y+ + DC GF Sbjct: 427 ETFFTTACMGRGHLCQGKLVDAYRYLHKEKDMDC-GF 462 >03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557, 6245482-6245681,6246125-6246519,6246776-6246888 Length = 530 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 386 CLFCACASQSRSILVCLLHRCYPA 457 CLFC SR ILVC L RC A Sbjct: 58 CLFCEANFISRRILVCDLLRCLVA 81 >01_06_1640 + 38836977-38836988,38837694-38838047,38838164-38838294, 38838554-38838860,38839036-38839349,38839507-38839645 Length = 418 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +1 Query: 145 DVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLRCT 264 D SQ + + IG +DI++ +++T KAV++ R T Sbjct: 12 DSSQFLLNGDGSVIGSPFDIQLECNSFTGSKAVQDHSRYT 51 >07_01_0493 - 3715677-3715907,3716675-3716861,3717631-3717818 Length = 201 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/60 (31%), Positives = 27/60 (45%) Frame = -2 Query: 509 LGYTSYGARNNETVAIRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLSVIE*ME*SN 330 LG T ARNN + R +EG++ TL+ H T E L +I +E +N Sbjct: 131 LGTTPKTARNNR-IHERGAQALGIEGVRAFTLVGWHLLPTNEQAEHGDHLPIIPIVEAAN 189 >02_03_0412 - 18749430-18749587,18749696-18749857,18750062-18750194, 18751640-18751744,18751818-18751935,18752232-18752320, 18752407-18753660,18753785-18753831,18754285-18754339, 18754783-18754884 Length = 740 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = -2 Query: 587 CGFRINEAILHLCYVNFLQHFHIHKHLGYTSYG-ARNNETVAIRAL-DNSDVE 435 C I+ L+ Y+ +QHFH+ ++ +T ++N+ T +I+ L D S ++ Sbjct: 278 CFMMISTKELYTIYITQVQHFHVGDNVTFTLLSRSKNSLTPSIKNLTDESTID 330 >11_02_0032 + 7564153-7564719,7564844-7565128,7565207-7565524, 7565612-7565839,7566662-7566762,7566852-7566933, 7567230-7567364,7567460-7567516,7568030-7568167 Length = 636 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 601 ISQGKRTTSXTKPIYSNGRLYHNGEPKAGHTSLRVFGMNA 720 I++G + K Y +G L+ G+P+ T +R G+NA Sbjct: 517 INRGNGSIQPKKHTYISGNLHPQGDPRTLATRVRSPGLNA 556 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,499,530 Number of Sequences: 37544 Number of extensions: 435704 Number of successful extensions: 946 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 946 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -