BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0274.Seq (789 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24440.1 68416.m03067 fibronectin type III domain-containing ... 34 0.12 At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 31 0.87 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 31 0.87 At1g09910.1 68414.m01115 expressed protein 30 2.0 At5g27230.1 68418.m03248 expressed protein ; expression support... 29 3.5 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 28 6.1 >At3g24440.1 68416.m03067 fibronectin type III domain-containing protein contains Pfam profile PF00041: Fibronectin type III domain Length = 602 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = +3 Query: 15 CLNSGWACSRRAQQCSTKAEHHKDKKCGCRIC*KAKENS--VLLPRCEPTK 161 CL S W C + + + E K+C C +C EN L CEP K Sbjct: 42 CLRSSWICKNASCRANVPKEDSFCKRCSCCVCHNFDENKDPSLWLVCEPEK 92 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 31.1 bits (67), Expect = 0.87 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -2 Query: 464 IRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLS 357 + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 845 MEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 31.1 bits (67), Expect = 0.87 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -2 Query: 464 IRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLS 357 + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 845 MEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At1g09910.1 68414.m01115 expressed protein Length = 675 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 3 NHEVCLNSGWACSRRAQQCSTKAEHHKDKK 92 NHE LN+G CS Q ++ H KD + Sbjct: 14 NHETALNAGHHCSEGTDQGTSGLSHRKDHR 43 >At5g27230.1 68418.m03248 expressed protein ; expression supported by MPSS Length = 948 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 94 VDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLRCT 264 V A+ +EK++K L D S E+ K KD+D+E + K+ VE+ + T Sbjct: 69 VKALELEKKEKELCLI-DESMKAKQSEFEKKEKDFDLEQKAEVEKRKREVEQLEKFT 124 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 160 NTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFL 255 N +DEY K DYD + +D T K+A + L Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDIL 573 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,478,006 Number of Sequences: 28952 Number of extensions: 360907 Number of successful extensions: 872 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -