BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0272.Seq (793 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 2.7 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 25 3.5 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 6.2 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 6.2 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 8.2 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 25.0 bits (52), Expect = 2.7 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = +3 Query: 462 IALWENNKVYFKILNTNVTNTWYWESALTGTATIWXSESTASIVSEPSG 608 +A W + KV KI T ++W+ E+ + T + I ++ G Sbjct: 275 LAKWRDEKVAVKIFFTTEESSWFRETEIYQTVLMRNENILGFIAADIKG 323 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 24.6 bits (51), Expect = 3.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 384 DVQGDDGRPAYGDGKDKTSPRV 449 D GD GRPAY D + +V Sbjct: 101 DRNGDGGRPAYSGNSDPSMDQV 122 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 6.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 709 SGSPHWPWGYXRAEL 753 SGS HWP+ R+EL Sbjct: 557 SGSEHWPFMTERSEL 571 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 6.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 709 SGSPHWPWGYXRAEL 753 SGS HWP+ R+EL Sbjct: 558 SGSEHWPFMTERSEL 572 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.4 bits (48), Expect = 8.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 458 LPADSRACLVLAVAVGRSAIVALNIIAQ 375 LP DS L L V + S V LN++A+ Sbjct: 255 LPPDSGEKLTLGVTILLSLTVFLNLVAE 282 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,461 Number of Sequences: 2352 Number of extensions: 12655 Number of successful extensions: 84 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -