BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0271.Seq (792 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 38 0.007 SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) 38 0.009 SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0) 37 0.016 SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) 37 0.022 SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) 36 0.028 SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) 35 0.066 SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) 35 0.066 SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) 35 0.066 SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0) 35 0.066 SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) 34 0.15 SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) 34 0.15 SB_27933| Best HMM Match : Mito_carr (HMM E-Value=6.9e-17) 32 0.46 SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29) 31 0.81 SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) 31 0.81 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 31 0.81 SB_14676| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_58000| Best HMM Match : MATH (HMM E-Value=1.1e-19) 31 1.1 SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) 31 1.4 SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) 31 1.4 SB_27075| Best HMM Match : rve (HMM E-Value=1.5e-16) 30 1.9 SB_13654| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) 30 2.5 SB_41962| Best HMM Match : RVT_1 (HMM E-Value=1.4e-18) 29 3.3 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) 29 3.3 SB_14466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_43597| Best HMM Match : TP2 (HMM E-Value=1.7) 29 3.3 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 29 4.3 SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05) 29 4.3 SB_39188| Best HMM Match : Ion_trans (HMM E-Value=4.9e-20) 29 5.7 SB_6137| Best HMM Match : NACHT (HMM E-Value=0.00017) 29 5.7 SB_5749| Best HMM Match : Gpi1 (HMM E-Value=7.8) 29 5.7 SB_15720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) 28 10.0 SB_28190| Best HMM Match : RVT_thumb (HMM E-Value=6.2) 28 10.0 SB_24170| Best HMM Match : rve (HMM E-Value=0.61) 28 10.0 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 28 10.0 >SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 74.9 bits (176), Expect = 7e-14 Identities = 39/82 (47%), Positives = 51/82 (62%) Frame = +1 Query: 256 IIYRASYFGFYDTARGMLPDPKNTPIVISWAIAQTVTTVAGIISYPFDTVRRRMMMQSGR 435 I+YR YFG YDT + +L ++ +VIS+ + VT AG+ SYP DT+RRRMMM SG Sbjct: 187 IVYRGFYFGLYDTLKPILLG-EDAGVVISFVLGYGVTVSAGLASYPIDTIRRRMMMTSGE 245 Query: 436 AKSDILYKNTIHCWATIAKTEG 501 A + YK +I C I K EG Sbjct: 246 A---VKYKGSIDCTIQILKKEG 264 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/59 (55%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = +2 Query: 83 SLCFVYPLDFARTRLAAD--VGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQG 253 SL FVY LD+ RTRLA D VGK G+R+F+G+ + K SDGL+GLYRGF +S G Sbjct: 127 SLFFVYSLDYCRTRLANDAKVGKKGGERQFNGMIDVYKKTIASDGLVGLYRGFVISCVG 185 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +3 Query: 498 GNLGFFKGAFSNVLRGTGGAFVLVLYDEIKKV 593 G + KGA +N+LRG GA VL +D+ K++ Sbjct: 264 GAMSLMKGAGANILRGMAGAGVLAGFDKFKEL 295 >SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/61 (36%), Positives = 32/61 (52%) Frame = +1 Query: 319 KNTPIVISWAIAQTVTTVAGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTE 498 + P+ V+ +YP D VRRRM M+ RA D YK+T+H +++I K E Sbjct: 157 RELPVNFKLMCGSLAGAVSQTATYPLDVVRRRMQMKGIRA--DFAYKSTLHAFSSIVKLE 214 Query: 499 G 501 G Sbjct: 215 G 215 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +2 Query: 80 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRG 232 T VYP+D +TR+ + ++ + +C K+ +++G IGLYRG Sbjct: 926 TGATAVYPIDLVKTRMQNQRAVLEAEKVYKNSIDCFFKVVRNEGPIGLYRG 976 Score = 35.9 bits (79), Expect = 0.038 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 388 YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEG 501 YP D V+ RM Q +++ +YKN+I C+ + + EG Sbjct: 932 YPIDLVKTRMQNQRAVLEAEKVYKNSIDCFFKVVRNEG 969 >SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) Length = 302 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 80 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRG 232 T+ V PLD +TRL + + G+ ++G+ +C KI+ ++GL Y+G Sbjct: 218 TASVAVNPLDVIKTRLQL-LNRPQGEPNYNGIIDCAKKIYSNEGLAAFYKG 267 >SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 200 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +2 Query: 80 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSD-GLIGLYRGF 235 T+ YPLD R+RLA V + + G+ + +IF ++ G++ LYRGF Sbjct: 11 TACSCTYPLDIVRSRLAFQVA---DEHTYCGICQTVKQIFMTEGGMVALYRGF 60 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +2 Query: 80 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGL-IGLYRGFGVS 244 TS YPLD R R+ DG + +S N ++ DG+ GLYRG ++ Sbjct: 119 TSQTLAYPLDVVRRRMQLAGTVADGHK-YSTCINTFISVYTEDGIRRGLYRGLSIN 173 >SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) Length = 95 Score = 36.7 bits (81), Expect = 0.022 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +2 Query: 80 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGF 235 T+ YPLD R RLA +++++GL N ++I++ +G+ YRG+ Sbjct: 2 TAALLTYPLDMVRARLAI-----TQKKKYTGLINAFTRIYRDEGMRTFYRGY 48 >SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +2 Query: 98 YPLDFARTRLAADVG-KGDGQREFSGLGNCISKIFKSDGLIGLYRG 232 YPL RTRL A KG GQ + + + + KI DG GLYRG Sbjct: 346 YPLSLVRTRLQAQAREKGGGQGD--NMVSVLRKIITEDGFKGLYRG 389 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +2 Query: 95 VYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQG 253 +YPL+ +TRLA + GQ + GL + S I++ +G+ YRG S+ G Sbjct: 248 IYPLEVLKTRLAI---RKTGQ--YRGLLHAASVIYQKEGIRSFYRGLFPSLLG 295 >SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 1024 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/56 (33%), Positives = 29/56 (51%) Frame = +2 Query: 80 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSV 247 TSLC YP + ARTRL + G++++ + + + +G GLY G G V Sbjct: 946 TSLC--YPHEVARTRLRQQESEFLGRQKYRSFFQTLGTVLREEGWRGLYGGLGTHV 999 >SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 35.9 bits (79), Expect = 0.038 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +2 Query: 86 LCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQG 253 +C +P ++ +T+L D + + + G +C+ K K G++GLYRG + G Sbjct: 55 ICCTFPTEYVKTQLQLD--EKAAKPIYRGPIDCVKKTVKGHGVLGLYRGLSSLLYG 108 >SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 306 Score = 35.1 bits (77), Expect = 0.066 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 2/86 (2%) Frame = +1 Query: 250 RYIIYRASYFGFYDTARGMLPDPKNTPIVISWAIAQTVTT--VAGIISYPFDTVRRRMMM 423 R IY ++ G Y+ + +L +T + I V++ + I+ P D V+ R Sbjct: 85 RQAIYSSTRLGAYEPIKNLLGATDSTSAALWKKIVAGVSSGVIGSAIATPTDLVKIRF-- 142 Query: 424 QSGRAKSDILYKNTIHCWATIAKTEG 501 Q+ + I YKN H + IAK EG Sbjct: 143 QAVKIGETIPYKNMFHAFYKIAKKEG 168 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 89 CFVYPLDFARTRLAADVGKGDGQR-EFSGLGNCISKIFKSDGLIGLYRGF 235 C P+D RTR G+ + G +CI K + +G++ LY+GF Sbjct: 227 CVASPVDIVRTRFMTQPKDTKGRPLVYQGTLDCIYKTVRHEGILALYKGF 276 >SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) Length = 773 Score = 35.1 bits (77), Expect = 0.066 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 98 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRG 232 YPLD R R+ + +G+G ++S + I +S+G IGL++G Sbjct: 700 YPLDVVRRRMQME--RGEGMFKYSSTWDGFKVIVRSEGFIGLFKG 742 Score = 32.7 bits (71), Expect = 0.35 Identities = 10/29 (34%), Positives = 22/29 (75%) Frame = +2 Query: 161 EFSGLGNCISKIFKSDGLIGLYRGFGVSV 247 ++SG+G ++KI++ +GL G ++G G ++ Sbjct: 590 KYSGVGGTLAKIYRDEGLYGYFKGNGTNI 618 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/58 (32%), Positives = 26/58 (44%) Frame = +1 Query: 328 PIVISWAIAQTVTTVAGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEG 501 P+V VA +YP D VRRRM M+ G Y +T + I ++EG Sbjct: 680 PVVAKLFCGAVAGAVAQSGTYPLDVVRRRMQMERGEGM--FKYSSTWDGFKVIVRSEG 735 >SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 264 Score = 35.1 bits (77), Expect = 0.066 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +2 Query: 80 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGF 235 T+ YPLD R+RLA V + G + CIS K G LY+GF Sbjct: 77 TACACTYPLDMVRSRLAFQVAQDQGYTTITQTIRCIS--VKEGGPKALYKGF 126 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 370 VAGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEG 501 V+ I+YP D VRRRM + +G Y I+ + K +G Sbjct: 185 VSQTIAYPLDVVRRRMQL-AGAVPDGHKYNTCINTLVNVYKDDG 227 >SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 313 Score = 35.1 bits (77), Expect = 0.066 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +2 Query: 98 YPLDFARTRLAADVGKGDGQRE-FSGLGNCISKIFKSDGLIGLYRGFGVSVQG 253 +PLD + RL G++ F+G +C K +++G GLY+G + G Sbjct: 45 HPLDTIKVRLQTMPRPKPGEKPMFTGTFDCAMKTIRNEGFFGLYKGMAAPITG 97 >SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) Length = 192 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/45 (31%), Positives = 31/45 (68%) Frame = +2 Query: 101 PLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGF 235 P+D A+TR+ ++ DG+ E+ G + +++I +++G+ L++GF Sbjct: 113 PVDIAKTRIQ-NMRIIDGKPEYKGTMDVLARIVRNEGVFALWKGF 156 >SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) Length = 247 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/42 (30%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 116 RTRLAADVGKGDGQR-EFSGLGNCISKIFKSDGLIGLYRGFG 238 R + V K G + + GLG+C+ +++++ GL G+++G G Sbjct: 183 RVKCLLQVQKESGTKARYQGLGDCLLQVYRTGGLRGVFKGLG 224 >SB_27933| Best HMM Match : Mito_carr (HMM E-Value=6.9e-17) Length = 187 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +1 Query: 343 WAIAQTVTTVAGIISYPFDTVRRRMMMQS---GRAKSDILYKNTIHCWATIAKTEG 501 + + T + A + P + V+ RM +Q R + Y+N H TIAK EG Sbjct: 8 FVLGATAASGACFFTNPLEVVKTRMQLQGELKSRGTYSVYYRNVFHASYTIAKYEG 63 >SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29) Length = 868 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 370 VAGIISYPFDTVRRRMMMQSGRAKSD--ILYKNTIHCWATIAKTEG 501 V I P D + +M +Q RA+S I Y+N H TIA+T G Sbjct: 214 VVAFIEGPIDLFKSKMQVQIIRAQSGAPIQYRNVFHAGYTIAQTYG 259 >SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 328 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +2 Query: 101 PLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVS 244 PLD R + + K G + G +C+ +I++ G+ G+Y+G V+ Sbjct: 157 PLD--RVKCILQIEKAFGGSSYGGPVDCLRRIYREAGVRGVYKGISVT 202 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 31.5 bits (68), Expect = 0.81 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +2 Query: 155 QREFSGLGNCISKIFKSDGLIGLYRGFGVS 244 Q ++G +C+ K+F S+GL G +RG ++ Sbjct: 294 QMAYTGSLDCLKKVFHSEGLRGCFRGMAIT 323 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 83 SLCFVYPLDFARTRLAAD--VGKGDGQREFSGLGNCISKIFKSDGLIGLYRG 232 S YP+D ++ AD G Q +++G +C+ KI+ S G+ +G Sbjct: 371 SWILTYPVDMVKSCYQADGRTNSGKPQYKYNGYADCVKKIYISGGVSAFGQG 422 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 164 FSGLGNCISKIFKSDGLIGLYRGFGVSVQG 253 ++G+ +C +I K + ++GLY+G + G Sbjct: 191 YNGVFDCFKQIIKRESVLGLYKGMASPLAG 220 >SB_14676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 31.1 bits (67), Expect = 1.1 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 4/108 (3%) Frame = +1 Query: 172 SRKLHQQDLQVRRSDRSVQ-RFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISW- 345 S+K + L V R V +F + + + SY G T++G+ PDP+ +I Sbjct: 537 SQKWMENCLMVLERSREVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIQAIIDMP 596 Query: 346 --AIAQTVTTVAGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWAT 483 + V + G ++Y ++ + +Q S +L K+ + W T Sbjct: 597 PPTDKEGVQRLIGTVNYLDKFIQNKAEIQG--PISQLLQKDAVFVWDT 642 >SB_58000| Best HMM Match : MATH (HMM E-Value=1.1e-19) Length = 1451 Score = 31.1 bits (67), Expect = 1.1 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 4/108 (3%) Frame = +1 Query: 172 SRKLHQQDLQVRRSDRSVQ-RFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISW- 345 S+K + L V R V +F + + + SY G T++G+ PDP+ +I Sbjct: 537 SQKWMENCLMVLERSREVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIQAIIDMP 596 Query: 346 --AIAQTVTTVAGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWAT 483 + V + G ++Y ++ + +Q S +L K+ + W T Sbjct: 597 PPTDKEGVQRLIGTVNYLDKFIQNKAEIQG--PISQLLQKDAVFVWDT 642 >SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) Length = 609 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 184 HQQDLQVRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPI 333 H+ ++RS +F +A+ + SY G TA G+ PDP+ +P+ Sbjct: 524 HKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKSPM 573 >SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 309 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 101 PLDFARTRLAADVGKGDGQRE-FSGLGNCISKIFKSDGLIGLYRG 232 PLD + RL A G+ F G +C K + +GL GLY+G Sbjct: 40 PLDLLKVRLQAMNQVKPGETAPFKGAMDCFMKTVRLEGLRGLYKG 84 >SB_27075| Best HMM Match : rve (HMM E-Value=1.5e-16) Length = 656 Score = 30.3 bits (65), Expect = 1.9 Identities = 23/97 (23%), Positives = 42/97 (43%), Gaps = 3/97 (3%) Frame = +1 Query: 202 VRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISW---AIAQTVTTV 372 + RS +F + + + SY G T++G+ PDP+ VI + V + Sbjct: 35 LERSREVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIKAVIDMPPPTDKEGVQRL 94 Query: 373 AGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWAT 483 G ++Y ++ + +Q S +L K+ I W T Sbjct: 95 IGTVNYLDKFIKNKAEIQG--PISQLLQKDAIFVWDT 129 >SB_13654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1451 Score = 30.3 bits (65), Expect = 1.9 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 3/97 (3%) Frame = +1 Query: 202 VRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISW---AIAQTVTTV 372 + RS +F + + + + SY G T++G+ PDP+ VI + V + Sbjct: 495 LERSREVGLKFNPSKVKLRVDKVSYVGHRLTSQGLQPDPEKIKAVIDMPPPRDKEGVQRL 554 Query: 373 AGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWAT 483 G ++Y ++ + +Q S +L K+ I W T Sbjct: 555 IGTVNYLDKFIQNKAEIQG--PISQLLQKDAIFVWDT 589 >SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) Length = 1702 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/106 (21%), Positives = 47/106 (44%), Gaps = 3/106 (2%) Frame = +1 Query: 175 RKLHQQDLQVRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISWAIA 354 R LH+ + R +R++ RF + +Y + + SY G + G PDP ++ + Sbjct: 1256 RALHK--VLERARERNI-RFNKSKIQYRLDKVSYMGEVVSNNGFTPDPAKVSAILKMPVP 1312 Query: 355 Q---TVTTVAGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWAT 483 Q + + G+I+Y + Q+ ++ ++ +HC T Sbjct: 1313 QCKKDLQRLLGMINYLSKAYDTEALTQTNDMHDEM--EHMVHCIMT 1356 >SB_41962| Best HMM Match : RVT_1 (HMM E-Value=1.4e-18) Length = 1052 Score = 29.5 bits (63), Expect = 3.3 Identities = 22/97 (22%), Positives = 42/97 (43%), Gaps = 3/97 (3%) Frame = +1 Query: 202 VRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISW---AIAQTVTTV 372 + RS +F + + + SY G T++G+ PDP+ +I + V + Sbjct: 340 LERSREVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIKAIIDMPPPTDKEGVQRL 399 Query: 373 AGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWAT 483 G ++Y ++ + +Q S +L K+ I W T Sbjct: 400 IGTVNYLDKFIQNKAEIQG--PISQLLQKDAIFVWDT 434 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -2 Query: 137 HRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTAS-SC 15 + RD RS+ +R++ RWL R R+P S+ R++S SC Sbjct: 6 NNNRDN-TRSQVRSRNSNRWLLRQQRQPQRHLSHKRSSSNSC 46 >SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) Length = 1053 Score = 29.5 bits (63), Expect = 3.3 Identities = 22/97 (22%), Positives = 42/97 (43%), Gaps = 3/97 (3%) Frame = +1 Query: 202 VRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISW---AIAQTVTTV 372 + RS +F + + + SY G T++G+ PDP+ +I + V + Sbjct: 826 LERSREVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIKAIIDMPPPTDKEGVQRL 885 Query: 373 AGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWAT 483 G ++Y ++ + +Q S +L K+ I W T Sbjct: 886 IGTVNYLDKFIQNKAEIQG--PISQLLQKDAIFVWDT 920 >SB_14466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 29.5 bits (63), Expect = 3.3 Identities = 22/97 (22%), Positives = 42/97 (43%), Gaps = 3/97 (3%) Frame = +1 Query: 202 VRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISW---AIAQTVTTV 372 + RS +F + + + SY G T++G+ PDP+ +I + V + Sbjct: 340 LERSREVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIKAIIDMPPPTDKEGVQRL 399 Query: 373 AGIISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWAT 483 G ++Y ++ + +Q S +L K+ I W T Sbjct: 400 IGTVNYLDKFIQNKAEIQG--PISQLLQKDAIFVWDT 434 >SB_43597| Best HMM Match : TP2 (HMM E-Value=1.7) Length = 272 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 174 RPENSRWPSPLPTSAARRVRAKSRGYTK 91 RP +SR S P+SA+RR ++SRG + Sbjct: 221 RPSSSRPSSARPSSASRRASSRSRGLAR 248 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -2 Query: 137 HRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRR 3 HR+ + RSR R R+ R R +SSC+RRR Sbjct: 275 HRKHRSHSRSRSPRSKRSRSPRKRRRSKSRSPRRYRDSSSCRRRR 319 >SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05) Length = 383 Score = 29.1 bits (62), Expect = 4.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 179 NCISKIFKSDGLIGLYRGFG 238 +C I++ +G+ G YRGFG Sbjct: 332 DCFRTIYQQEGIFGFYRGFG 351 >SB_39188| Best HMM Match : Ion_trans (HMM E-Value=4.9e-20) Length = 551 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 184 HQQDLQVRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISWA 348 H +D +R + +V+ FR +II G+Y A + D K I SWA Sbjct: 147 HARDNDLRSNTTTVRAFRYSAMSFIIIHLFACGWYYLACDNMADGKGKCITKSWA 201 >SB_6137| Best HMM Match : NACHT (HMM E-Value=0.00017) Length = 1243 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/67 (25%), Positives = 29/67 (43%) Frame = +3 Query: 441 ERYPVQEHHPLLGYHCQDRGNLGFFKGAFSNVLRGTGGAFVLVLYDEIKKVCKSNVRIVT 620 E Y Q+ ++ Y C + ++ F + + + G +++ KKV K IVT Sbjct: 329 EHYSEQDQESIIRYICDNEEHIAFVLDGYDELPSSSKGPLDMII--NAKKVLKQCYVIVT 386 Query: 621 IISNVIP 641 N IP Sbjct: 387 SRMNQIP 393 >SB_5749| Best HMM Match : Gpi1 (HMM E-Value=7.8) Length = 226 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 184 HQQDLQVRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISWA 348 H +D +R + +V+ FR +II G+Y A + D K I SWA Sbjct: 167 HARDNDLRSNTTTVRAFRYSAMSFIIIHLFACGWYYLACDNMADGKGKCITKSWA 221 >SB_15720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1277 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 128 RDGYVRSRGGTRSTERWLRRHHRRPDY-QRSNARTASSCQR 9 +DG V +RG TR + R H RR + R + R +S+ R Sbjct: 591 QDGQVTTRGHTRRSSNTTRSHTRRSSHTTRGHTRRSSNTTR 631 >SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) Length = 635 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +1 Query: 184 HQQDLQVRRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPK 321 H+ ++RS + +F +A+ + SY G TA G+ PDP+ Sbjct: 334 HKMIAVLKRSRKIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPE 379 >SB_28190| Best HMM Match : RVT_thumb (HMM E-Value=6.2) Length = 315 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 205 RRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVIS 342 R DR++ RF + +Y + + SY G + +G PDP + + Sbjct: 39 RARDRNI-RFNKEKIQYRLDKVSYMGEVVSEKGFTPDPSKVSAIFN 83 >SB_24170| Best HMM Match : rve (HMM E-Value=0.61) Length = 768 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 205 RRSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVIS 342 R DR++ RF + +Y + + SY G + +G PDP + + Sbjct: 252 RARDRNI-RFNKEKIQYRLDKVSYMGEVVSEKGFTPDPSKVSAIFN 296 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +1 Query: 208 RSDRSVQRFRCVRARYIIYRASYFGFYDTARGMLPDPKNTPIVISWAIAQTVTTVA 375 +S+ S+Q + Y + +FG+ + G+ PDPK V++ QT++T + Sbjct: 631 KSEGSLQTLNKSKCEYGKEKLEFFGYVFSKDGISPDPKKVEDVVN---LQTLSTAS 683 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,894,138 Number of Sequences: 59808 Number of extensions: 431686 Number of successful extensions: 1489 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 1310 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1482 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -