BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0269.Seq (689 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 25 0.77 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 4.1 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 4.1 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 9.5 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 9.5 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 24.6 bits (51), Expect = 0.77 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 314 GCKVGTC*ASLSSFNICKSVSSLHCQ 237 GCK G C ++S +C + S+L Q Sbjct: 139 GCKKGVCTMEINSDTMCVTFSNLGIQ 164 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 261 ECFFPALSSPRNKSLPDFFHRPRNPNTPV 175 + F S +NKSL F RN +TP+ Sbjct: 406 DTFLDLWSDYQNKSLAAFDFVARNSDTPI 434 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 4.1 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -2 Query: 508 ASRQ*ATSLVQPWTPADVAGXTRRPGTLSRPPRGSSRATH 389 +SR TS T A PG S+PP +S H Sbjct: 97 SSRSVMTSCSSVPTTASYGSDLYFPGATSQPPTDNSHVHH 136 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 427 VFLVDACXRPRLPESKAELDSLLTDETPVT 516 +FL C PRL + TDE VT Sbjct: 15 IFLSSMCLDPRLNSKIQVSGASTTDECQVT 44 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 78 VICYVVKWII 49 VICYV W I Sbjct: 26 VICYVASWAI 35 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,084 Number of Sequences: 336 Number of extensions: 2847 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -