BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0269.Seq (689 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 32 0.020 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 31 0.026 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 29 0.14 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 28 0.24 AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha su... 27 0.56 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 27 0.56 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 27 0.56 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 26 1.3 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 26 1.3 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 25 3.0 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 3.0 AY045760-3|AAK84944.1| 168|Anopheles gambiae D7-related 2 prote... 24 3.9 AJ133853-1|CAB39728.1| 168|Anopheles gambiae D7-related 2 prote... 24 3.9 AJ000036-1|CAA03872.1| 150|Anopheles gambiae D7r2 protein protein. 24 3.9 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 9.1 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 31.9 bits (69), Expect = 0.020 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = +1 Query: 274 KDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVXRDYFPAVDAIVFLV 438 + D L V T S S+ F FD+GG + R+ F V AI+F V Sbjct: 170 QQDVLRTRVKTTGIVETHFSFKSIHFKMFDVGGQRSERKKWIHCFEGVTAIIFCV 224 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 31.5 bits (68), Expect = 0.026 Identities = 18/55 (32%), Positives = 25/55 (45%) Frame = +1 Query: 274 KDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVXRDYFPAVDAIVFLV 438 + D L VPT + +RF D+GG + RR F V +I+FLV Sbjct: 170 EQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLV 224 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 29.1 bits (62), Expect = 0.14 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 274 KDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVXRDYFPAVDAIVFLV 438 + D L PT + S+ F D+GG + RR F V +I+FLV Sbjct: 27 EQDILRARAPTTGILEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLV 81 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 28.3 bits (60), Expect = 0.24 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 334 IGSMRFTTFDLGGHQQARRVXRDYFPAVDAIVFLVDAC 447 + + F FD+GG + RR F V AI+F V AC Sbjct: 203 VDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIF-VTAC 239 >AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha subunit AgGq5 protein. Length = 127 Score = 27.1 bits (57), Expect = 0.56 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 343 MRFTTFDLGGHQQARRVXRDYFPAVDAIVFLV 438 +RF D+GG + RR F V +I+FLV Sbjct: 7 IRFRMVDVGGQRSERRKWIHCFENVTSIIFLV 38 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 27.1 bits (57), Expect = 0.56 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 343 MRFTTFDLGGHQQARRVXRDYFPAVDAIVFLV 438 +RF D+GG + RR F V +I+FLV Sbjct: 7 IRFRMVDVGGQRSERRKWIHCFENVTSIIFLV 38 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 27.1 bits (57), Expect = 0.56 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 343 MRFTTFDLGGHQQARRVXRDYFPAVDAIVFLV 438 +RF D+GG + RR F V +I+FLV Sbjct: 7 IRFRMVDVGGQRSERRKWIHCFENVTSIIFLV 38 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 334 IGSMRFTTFDLGGHQQARRVXRDYFPAVDAIVFLV 438 + S+ F D+GG + RR F V +I+FLV Sbjct: 3 LDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLV 37 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 334 IGSMRFTTFDLGGHQQARRVXRDYFPAVDAIVFLV 438 + S+ F D+GG + RR F V +I+FLV Sbjct: 3 LDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLV 37 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +2 Query: 155 MFILDWFTGVLGFLGLWKKSGKLLFLGLDNAGKKHSYI 268 ++ + FTG+ + W+K + +F GL + KH ++ Sbjct: 357 VYFVPAFTGL--YAPYWRKDARGIFCGLTSFTTKHHFV 392 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 439 RPGTLSRPPRGSSRATHDAPADA 371 R GTL P G +R + AP++A Sbjct: 1152 REGTLPTVPHGRNRRSRSAPSEA 1174 >AY045760-3|AAK84944.1| 168|Anopheles gambiae D7-related 2 protein protein. Length = 168 Score = 24.2 bits (50), Expect = 3.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 181 SVGISWSMEKVGQALVSGT*QCREETLLHMLKDD--RLAQHVP 303 SVG+ W + +GQA T + E+ + LKD L Q+ P Sbjct: 8 SVGLVWCLISLGQARKESTVEECEKNIGDSLKDRVCELRQYTP 50 >AJ133853-1|CAB39728.1| 168|Anopheles gambiae D7-related 2 protein protein. Length = 168 Score = 24.2 bits (50), Expect = 3.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 181 SVGISWSMEKVGQALVSGT*QCREETLLHMLKDD--RLAQHVP 303 SVG+ W + +GQA T + E+ + LKD L Q+ P Sbjct: 8 SVGLVWCLISLGQARKESTVEECEKNIGDSLKDRVCELRQYTP 50 >AJ000036-1|CAA03872.1| 150|Anopheles gambiae D7r2 protein protein. Length = 150 Score = 24.2 bits (50), Expect = 3.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 181 SVGISWSMEKVGQALVSGT*QCREETLLHMLKDD--RLAQHVP 303 SVG+ W + +GQA T + E+ + LKD L Q+ P Sbjct: 8 SVGLVWCLISLGQARKESTVEECEKNIGDSLKDRVCELRQYTP 50 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 188 GFLGLWKKSGKLLFL 232 G G+W+KSG +FL Sbjct: 910 GSFGVWEKSGSSVFL 924 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 656,717 Number of Sequences: 2352 Number of extensions: 12206 Number of successful extensions: 47 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -