BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0268.Seq (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.10 |qcr2||ubiquinol-cytochrome-c reductase complex core ... 34 0.018 SPBC18E5.12c |mas2|SPBC23G7.02c|mitochondrial processing peptida... 31 0.13 >SPCC613.10 |qcr2||ubiquinol-cytochrome-c reductase complex core protein Qcr2|Schizosaccharomyces pombe|chr 3|||Manual Length = 426 Score = 33.9 bits (74), Expect = 0.018 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +3 Query: 264 VTIAFKAGSRYEPQAELGLSHVLGSAGGLTTXNISSXLXQRKLSQIGAYVSASGDREFI 440 +++ AGSRY+P A G+SH+L TT S+ R+ +G +S RE I Sbjct: 45 LSVVINAGSRYQPDA--GVSHLLEKFAFKTTEERSALRITRESELLGGQLSTQITREHI 101 >SPBC18E5.12c |mas2|SPBC23G7.02c|mitochondrial processing peptidase complex alpha subunit Mas2|Schizosaccharomyces pombe|chr 2|||Manual Length = 494 Score = 31.1 bits (67), Expect = 0.13 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +3 Query: 279 KAGSRYEPQAELGLSHVLGSAGGLTTXNISSXLXQRKLSQIGAYVSASGDREFIXY 446 KAGSRYE + G+SH + T + KL +G S RE + Y Sbjct: 74 KAGSRYETKKFSGVSHFMDRLAFQATERTPVGEMKAKLENLGGNYMCSTSRESMIY 129 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,750,459 Number of Sequences: 5004 Number of extensions: 26439 Number of successful extensions: 56 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -