BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0268.Seq (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0648 - 30844289-30844341,30844536-30844648,30845435-308454... 41 9e-04 03_02_0138 + 5837813-5838490,5839000-5839164,5839289-5839426,583... 29 2.8 >01_06_0648 - 30844289-30844341,30844536-30844648,30845435-30845484, 30845572-30845642,30845725-30845797,30846744-30846841, 30846936-30847002,30847150-30847230,30847312-30847479, 30847563-30847730,30847813-30848109,30848205-30848426, 30849287-30849325 Length = 499 Score = 40.7 bits (91), Expect = 9e-04 Identities = 25/77 (32%), Positives = 33/77 (42%) Frame = +3 Query: 252 PVTRVTIAFKAGSRYEPQAELGLSHVLGSAGGLTTXNISSXLXQRKLSQIGAYVSASGDR 431 P V + GS YE A G SH+L +T N S R++ IG VSAS R Sbjct: 89 PAASVGLYIDCGSIYETPASSGASHLLERMAFKSTTNRSHLRLVREVEAIGGNVSASASR 148 Query: 432 EFIXYXLEGXXGXIXXM 482 E + Y + + M Sbjct: 149 EQMCYTYDAFKAYVPEM 165 >03_02_0138 + 5837813-5838490,5839000-5839164,5839289-5839426, 5839496-5839647,5839754-5839862,5840551-5840649, 5840739-5840804,5840891-5840998,5841820-5841906 Length = 533 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = +3 Query: 264 VTIAFKAGSRYEPQAELGLSHVLGSAGGLTTXNISSXLXQRKLSQIGAYVSASGDREFIX 443 V + AGSRYE + G++H + T + ++ + ++ IG +++A RE Sbjct: 123 VGVWIDAGSRYETEDSAGVAHFVEHMLFKGTGDRNAAQLEEEIENIGGHLNAYTSREQTT 182 Query: 444 Y 446 Y Sbjct: 183 Y 183 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,654,959 Number of Sequences: 37544 Number of extensions: 179669 Number of successful extensions: 326 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 326 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -