BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0265.Seq (805 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6RYS1 Cluster: Putative uncharacterized protein; n=1; ... 33 8.4 UniRef50_Q6BQR8 Cluster: DNA polymerase epsilon subunit B; n=2; ... 33 8.4 >UniRef50_A6RYS1 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 548 Score = 33.1 bits (72), Expect = 8.4 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +2 Query: 527 SYIREPASKXSTQNKSHSTXIRRFTCGYV 613 SYIREP S+ ST+N+ HS + T YV Sbjct: 171 SYIREPPSESSTENEKHSKKQAKKTIDYV 199 >UniRef50_Q6BQR8 Cluster: DNA polymerase epsilon subunit B; n=2; Saccharomycetaceae|Rep: DNA polymerase epsilon subunit B - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 669 Score = 33.1 bits (72), Expect = 8.4 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +3 Query: 435 NANVNHLYRSFKLLSYIIKDNIRFSCPSFNSHIYVSRQAKXLHKTNRIPL 584 N+NV++ + L+S + N F PSF+S +S+ +KTN I L Sbjct: 176 NSNVDYFNNRYHLISDRLSRNENFQKPSFSSISSISKSLSHNNKTNEITL 225 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 663,839,706 Number of Sequences: 1657284 Number of extensions: 12860577 Number of successful extensions: 20612 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20609 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 69143070360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -