BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0265.Seq (805 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC330.06c |||thioredoxin peroxidase|Schizosaccharomyces pombe|... 26 5.5 SPAC1565.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 5.5 SPBC1604.18c |||vacuolar sorting protein |Schizosaccharomyces po... 25 9.5 >SPCC330.06c |||thioredoxin peroxidase|Schizosaccharomyces pombe|chr 3|||Manual Length = 156 Score = 26.2 bits (55), Expect = 5.5 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 679 KNLDSKSLKGIYFTVPSDVF--KAYVTARESPNXSGMRFV 566 K +K + GIY +DVF KA+ + + SG+ FV Sbjct: 55 KQFAAKGISGIYVVAVNDVFVTKAWKKSFDGGEQSGVHFV 94 >SPAC1565.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 166 Score = 26.2 bits (55), Expect = 5.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 97 IDFTEMRQRQSHLQLSKRFNLNSFLLSPTAFDLQFTNQ 210 IDF +++ + SKR L+ L PT +++F N+ Sbjct: 67 IDFRFFSKKKKNEHFSKRRKLSKVLTPPTNDEIKFVNR 104 >SPBC1604.18c |||vacuolar sorting protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 449 Score = 25.4 bits (53), Expect = 9.5 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 409 YISMKNIINVACILQRLSVLHCKMFDLRYYV-DVFKNT 299 Y+ KNI +AC++ ++ C + Y D F++T Sbjct: 155 YVIRKNIEKLACLVHNEAMRRCSSYTSAIYTWDFFQDT 192 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,922,834 Number of Sequences: 5004 Number of extensions: 59085 Number of successful extensions: 93 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 390427050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -