Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= tesV0263.Seq
(847 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 24 2.0
AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 24 2.0
AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 6.2
DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 8.2
DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 8.2
DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 8.2
DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 8.2
DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 8.2
DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 8.2
DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 8.2
AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 8.2
AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 8.2
AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 8.2
AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 8.2
AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 8.2
AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 8.2
AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 8.2
AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 8.2
AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 8.2
>AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone
esterase protein.
Length = 567
Score = 23.8 bits (49), Expect = 2.0
Identities = 8/31 (25%), Positives = 16/31 (51%)
Frame = -3
Query: 626 WVSQVEVELLGPSIQNYIPWVSGPVH*RGLY 534
++ + +E++ +PWV+G GLY
Sbjct: 315 FIDRTPIEIINSGDVQDVPWVTGVTSEEGLY 345
>AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein.
Length = 567
Score = 23.8 bits (49), Expect = 2.0
Identities = 8/31 (25%), Positives = 16/31 (51%)
Frame = -3
Query: 626 WVSQVEVELLGPSIQNYIPWVSGPVH*RGLY 534
++ + +E++ +PWV+G GLY
Sbjct: 315 FIDRTPIEIINSGDVQDVPWVTGVTSEEGLY 345
>AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine
receptor protein.
Length = 694
Score = 22.2 bits (45), Expect = 6.2
Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 5/51 (9%)
Frame = -1
Query: 475 SCRAMPSASQHMPAGMTTSPRSSQP---LLPMSP--LGMDQILGLVSDVHI 338
S A+ S S P G ++SP S P +SP LG + G +SD+ +
Sbjct: 72 SAAAITSTSPSYPGGGSSSPSPSSPSSFFSSVSPTSLGSENYTG-ISDLFV 121
>DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 144 PNPRFGP 150
>AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein.
Length = 400
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 392 PNPRFGP 398
>AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex
determiner protein.
Length = 385
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 377 PNPRFGP 383
>AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex
determiner protein.
Length = 401
Score = 21.8 bits (44), Expect = 8.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 355 PNPRFGP 375
PNPRFGP
Sbjct: 393 PNPRFGP 399
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 257,950
Number of Sequences: 438
Number of extensions: 6635
Number of successful extensions: 24
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27188448
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -